KEGG   Pseudoxanthomonas spadix: DSC_07040Help
Entry
DSC_07040         CDS       T01643                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd00010  Glycolysis / Gluconeogenesis
psd00051  Fructose and mannose metabolism
psd00562  Inositol phosphate metabolism
psd01100  Metabolic pathways
psd01110  Biosynthesis of secondary metabolites
psd01120  Microbial metabolism in diverse environments
psd01130  Biosynthesis of antibiotics
psd01200  Carbon metabolism
psd01230  Biosynthesis of amino acids
Module
psd_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:psd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DSC_07040 (tpiA)
   00051 Fructose and mannose metabolism
    DSC_07040 (tpiA)
   00562 Inositol phosphate metabolism
    DSC_07040 (tpiA)
Enzymes [BR:psd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DSC_07040 (tpiA)
Exosome [BR:psd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DSC_07040 (tpiA)
  Exosomal proteins of bladder cancer cells
   DSC_07040 (tpiA)
  Exosomal proteins of melanoma cells
   DSC_07040 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF4849
Motif
Other DBs
NCBI-ProteinID: AER56059
UniProt: G7USI7
Position
1318633..1319385
Genome map
AA seq 250 aa AA seqDB search
MRRRIVAGNWKLHGSRAFATQLVSELVAALPLGGVELVILPPLPYLGDLIEDFEDQPIAF
GAQDVSANEKGAYTGEVSAAMLADVGARYGLVGHSERRRYHHESNALVARKFLAARNAGL
TPVLCVGETLEQREAGQTEAVIADQLESVLALAGVAAFDGAVVAYEPVWAIGTGRSASPQ
QAQAVHAFIRGVVARHDARIGDSLPLLYGGSVRPDNAAELFSQADVDGGLVGGASLVAAD
FLAIARAAAG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcaggatcgtcgccggaaactggaagctgcatggcagccgcgccttcgccacc
caactggtgtcggaactggtggccgcgctgccattgggcggcgtggagctggtgatcctg
ccgccactgccctatctgggcgacctgatcgaggatttcgaagaccagcccatcgcattt
ggggcgcaggacgtcagcgccaacgagaaaggcgcctacaccggtgaagtctccgccgcg
atgctggccgatgtgggcgcgcgttacggcctggtcggccattccgaacgccgccgctat
caccacgagagcaacgcgctggtcgcgcgcaagtttctcgctgcgcgcaacgcgggcctg
acgccggtgctgtgcgtgggcgaaaccctggagcagcgcgaggccggccagaccgaggcg
gtgatcgccgaccagctcgagtcggtgctggccctggccggcgtggccgccttcgacggc
gcggtggtggcctacgagccggtctgggcgatcggcaccggccgcagcgcctcgccgcag
caggcccaggcggtccatgccttcatccgtggcgtggtggcgcggcacgatgctagaatt
ggcgattcactgccgctgctgtacggcggaagcgtcaggcctgacaacgccgccgaactg
ttttcgcaagccgatgtcgatggtgggctggtcggaggcgcctcgctggtggctgccgac
ttcctggccatcgcgcgtgcggcggccggctga

DBGET integrated database retrieval system