KEGG   Pseudoxanthomonas spadix: DSC_09340
Entry
DSC_09340         CDS       T01643                                 

Definition
(GenBank) biphenyl 2,3-dioxygenase ferredoxin subunit (BphA3)
  KO
K18087  biphenyl 2,3-dioxygenase ferredoxin component
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd00621  Dioxin degradation
psd01100  Metabolic pathways
psd01120  Microbial metabolism in diverse environments
psd01220  Degradation of aromatic compounds
Module
psd_M00543  Biphenyl degradation, biphenyl => 2-oxopent-4-enoate + benzoate
Brite
KEGG Orthology (KO) [BR:psd00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    DSC_09340
SSDB
Motif
Pfam: Rieske Rieske_2
Other DBs
NCBI-ProteinID: AER56516
UniProt: G7UWK9
Position
1835124..1835453
AA seq 109 aa
MKFTKVCERSDVPEGEALKVESGDTPVAIFNVDGELFATQDHCTHGDWSLSEGGYLDGDV
VECSLHMGKFCVRTGKVKSPPPCEALKIFPIRIEGNDVLIDFEAGYLTP
NT seq 330 nt   +upstreamnt  +downstreamnt
atgaaatttaccaaagtctgtgagcgaagcgatgtgcccgaaggcgaagccctgaaggtc
gaaagtggagacacccccgtcgcgatcttcaatgtggatggcgaactgtttgcgacccag
gaccactgcacccacggtgactggtccctgtccgagggcggctaccttgatggtgacgtg
gtggaatgctcactgcacatggggaagttttgcgttcgcacgggcaaggtcaaatcgccg
ccgccctgtgaggcattgaagatatttccaatccgcatcgagggaaatgacgtgctgatc
gacttcgaagcggggtatctgacgccatga

DBGET integrated database retrieval system