KEGG   Pseudoxanthomonas spadix: DSC_09350
Entry
DSC_09350         CDS       T01643                                 

Definition
(GenBank) 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase
  KO
K08690  cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase [EC:1.3.1.56]
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd00621  Dioxin degradation
psd01100  Metabolic pathways
psd01120  Microbial metabolism in diverse environments
psd01220  Degradation of aromatic compounds
Module
psd_M00543  Biphenyl degradation, biphenyl => 2-oxopent-4-enoate + benzoate
Brite
KEGG Orthology (KO) [BR:psd00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    DSC_09350
Enzymes [BR:psd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.56  cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase
     DSC_09350
SSDB
Motif
Pfam: adh_short adh_short_C2 KR 3Beta_HSD Epimerase TrkA_N bMG3
Other DBs
NCBI-ProteinID: AER56518
UniProt: G7UWL1
Position
1836720..1837553
AA seq 277 aa
MKLTGEVVLITGGASGLGRALVDRFVAEGAKVAVLDKSAERLAQLETDHGDNVLGVTGDV
RSLEDQKQAASRCVAKFGKIDTLIPNAGIWDYSTALVDLPEESLDAAFDEVFHINVKGYI
HAVKACLPALVASRGNVIFTISNAGFYPNGGGPLYTAAKHAIVGLVRELAFELAPYVRVN
GVGPGGINSDLRGPSSLGMGGKAISTVPLADMLKSVLPIGRMPEAEEYTGAYVFFATRGD
AAPATGALLNYDGGLGVRGFFSGAGGNDLLEKLNINP
NT seq 834 nt   +upstreamnt  +downstreamnt
atgaaattgacaggcgaagtggtgttgatcacgggaggcgcctccgggttggggcgagcg
ctcgtggaccgattcgtggccgaaggcgcaaaagtggcagtgctggacaagtcggccgag
cgtctcgcacagctggaaaccgatcatggcgacaacgtgcttggcgtcaccggcgatgtc
cgttcactggaagatcagaagcaggcggccagccgctgcgtggccaagttcggaaaaatc
gacaccctgatccccaatgcaggcatttgggattactcgacggccttggtcgacctgccc
gaagagagcctcgatgccgcgttcgatgaggtctttcacatcaatgtcaagggttatatc
catgcagtgaaggcctgcctgccggccttggtcgccagccgtggcaacgtgatcttcacg
atctccaatgcgggcttctatcccaatggcggaggccctctctacaccgcagccaagcac
gccattgtgggcctggtgcgtgaactggcgttcgagctggcgccatacgtgcgcgtcaac
ggggtggggccgggcggcatcaatagcgatctgagaggcccctcctcgctggggatgggc
ggcaaggcgatttcgaccgtgccgcttgccgacatgctcaagtcggtgcttccgatcggc
cgcatgcctgaggccgaggagtacaccggggcctatgtgttttttgccacgcgaggcgat
gcggcgcctgcgaccggggccttgctgaactacgacggtggcttgggcgttcgtggattc
ttctcgggtgccgggggtaatgacctgctcgaaaagctgaatatcaacccctga

DBGET integrated database retrieval system