KEGG   Pseudoxanthomonas spadix: DSC_10740Help
Entry
DSC_10740         CDS       T01643                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd00900  Terpenoid backbone biosynthesis
psd01100  Metabolic pathways
psd01110  Biosynthesis of secondary metabolites
psd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DSC_10740
Enzymes [BR:psd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     DSC_10740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C Semialdhyde_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AER56792
UniProt: G7UPH9
Position
2123791..2124999
Genome map
AA seq 402 aa AA seqDB search
MDTTTLPSRNVAVLGATGSIGSSALDLIARHPGRLRATVLAAGSNVAALVALCRSHRPEH
AVIADQACFTQLRDALAEAGLATQAHAGSAALDALVAGDACDTVVAAIVGAAGLSSTLAA
AGAGKRLLLANKESLVLAGALVIAVAEASGAQIVPIDSEHNAVFQCLGSRQAGAQVRRIV
LTASGGPFRGRSRASLETVTVAQAVAHPKWSMGPKISVDSATLMNKGLELIEAAHLFNVG
RERLDVLVHPQSLVHSLVEFIDGSTLAQLGLPDMRTALSVGLGWPQRIDSGVAGLDLLRH
GTLEFEAPDLDAFPCLRLAWSALESGGAAPAVLNAANETAVSAFLQGKIGFLAIPALVED
ALAAHAHAPAGSLEALLAADGLARHFSQGWIHRTTTGQARSA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggacaccaccacgctcccctcacgcaacgtcgcggtcctgggcgcgaccggctcgatc
ggcagctcggccctggatctgatcgcgcgccaccctggcaggctgcgcgccaccgtgctg
gccgccggcagcaatgtcgctgcgctggtcgcgctgtgccgcagccatcgccccgagcac
gccgtgatcgccgaccaggcctgcttcacccagctgcgcgacgccctggccgaggcgggc
ctggcgacccaggcgcacgccggcagtgcggcgctggatgcgctggtggccggcgacgcc
tgcgacaccgtggtggcggccatcgtcggtgccgccggcctgtcctcgaccctggccgca
gccggcgccggcaagcggctgctgctggccaacaaggaatcgctggtcctggccggcgcg
ctggtgatcgccgtcgccgaggcctccggcgcgcagatcgtgccgatcgacagcgaacac
aacgccgtcttccagtgcctgggctcgcgccaggccggcgcgcaggtgcgccggatcgtg
ctgaccgcctccggtggcccgttccgcggccgcagccgtgcctcgctggaaacggtcacc
gtcgcccaggccgtggcccatccaaagtggtcgatgggcccgaagatctcggtcgactcg
gccaccctgatgaacaagggcctggagctgatcgaggccgcgcacctgttcaacgtcggc
cgcgagcgcctggacgtgctggtccatccgcagagcctggtccactcgctggtggagttc
atcgacggctcgaccctggcccagctgggcctgccggacatgcgcaccgccctgtcggtg
ggcctgggctggccgcagcgcatcgattcgggggtggccgggctggatcttctgcgccac
ggcaccctggaattcgaagcgccggacctagacgccttcccctgcctgcgcctggcctgg
agcgcacttgagagcggcggtgcggccccggcggtgctgaacgccgccaacgaaactgct
gtttcagcgtttcttcagggcaaaatcggtttcctagcgatccctgcattggtcgaggac
gccctcgccgcccacgcgcatgccccggccggaagcctggaggcgctgctggcggccgat
ggtctcgcgcggcatttcagccagggctggatccaccgcaccaccacaggccaagcccgt
tccgcatga

DBGET integrated database retrieval system