KEGG   Pseudoxanthomonas spadix: DSC_11135Help
Entry
DSC_11135         CDS       T01643                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd00300  Lysine biosynthesis
psd01100  Metabolic pathways
psd01120  Microbial metabolism in diverse environments
psd01230  Biosynthesis of amino acids
Module
psd_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:psd00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    DSC_11135
Enzymes [BR:psd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     DSC_11135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: AER56871
UniProt: G7UPY7
Position
complement(2212696..2213883)
Genome map
AA seq 395 aa AA seqDB search
MKAASGSHDGDARAPADAAPTEPVLALACELIARPSVTPEDAGCQALIASRLQAAGFTCE
QLRFGRVDNLWATHGSGAPVLVLLGHTDVVPTGPVEAWTSDPFKPQVRQGNLYGRGSADM
KGSVAAFVVAAEQYVAAHPDHAGTLAVLLTSDEEGDAIDGVRRVARVLAERGQGIDWCIT
GEPSSTHTLGDLLRVGRRGSLTGTLTVKGVQGHVAYPHKARNPIHQAAPALAELTSRQWD
DGYESFPPTSLQVSNIHAGTGASNVIPGQLQVLFNLRYNPHWDAPRLEAEVAALLERHGL
EYALQWHRSGEPFYTPEGTLRCVARQVLGEFAGAPPQESTGGGTSDARFIAPLGAQCIEV
GPVNASIHQIDEHVRVADLERLPDLYRTLIERLLA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgccagcggctcccacgacggcgacgcgcgcgcgcctgccgatgctgcgccc
accgagccggtcctggcgctggcctgcgagctgatcgcccggccttcggtcacacccgag
gacgccggctgccaggcgctgatcgcctcgcgcctgcaggcggctggcttcacctgcgag
caactgcgctttggccgggtcgacaacctgtgggccacgcacggcagcggcgcgccggtg
ctggtgctgctgggccataccgacgtggtgccgaccgggccggtcgaggcctggaccagt
gatccgttcaagccgcaggtgcgccagggcaacctctacggccgcggcagcgccgacatg
aagggcagcgtggctgcgttcgtggtcgctgccgagcaatacgtggctgcccatccggac
catgccggcaccctggcggtgctgctcaccagtgacgaggaaggcgatgccatcgatggc
gtgcgccgggtcgccagggtgttggccgagcgcgggcagggcatcgactggtgcatcacc
ggcgagccgtcttccacgcacacgctgggcgacctgctgcgtgtgggccgtcgcggcagc
ctgaccggcaccttgacggtcaagggcgtgcagggccacgtggcctatccgcacaaggcc
cgcaatccgatccaccaggccgcccccgccctggccgagctgacctcgcgccagtgggac
gacggctatgaaagcttcccgccgaccagcctgcaggtgtccaacatccatgccggcacc
ggcgccagcaacgtgatcccgggccagctgcaggtgctgttcaacctgcgctacaacccg
cactgggatgcgcccaggctggaggccgaagtcgccgcactgctggagcgccacggcctg
gagtacgcgctgcaatggcatcgcagcggcgagccgttctacacgcccgaaggcacgctg
cgctgcgtggcgcgtcaggtgctgggcgagtttgccggagcgccgccgcaggaaagcacc
ggcggcggcacctcggacgcgcgcttcatcgccccgctgggcgcgcagtgcatcgaggtc
gggccggtcaacgccagcatccaccagatcgacgagcacgtgcgcgtggccgacctggag
cggctgccggacctgtatcgcacgttgatcgaacggttgctggcgtaa

DBGET integrated database retrieval system