KEGG   Pseudoxanthomonas spadix: DSC_11700Help
Entry
DSC_11700         CDS       T01643                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:psd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DSC_11700 (recR)
DNA repair and recombination proteins [BR:psd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     DSC_11700 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      DSC_11700 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim Laminin_EGF zf-RING_9
Motif
Other DBs
NCBI-ProteinID: AER56984
UniProt: G7UQI1
Position
complement(2338308..2338904)
Genome map
AA seq 198 aa AA seqDB search
MSASLLEQLIDALRVLPGVGGKSAQRMAYQLLERDRDGGRRLSAALAQAMEHVGHCAQCR
DFTEGPLCAICASASRDRHQLCAVETPADRLAIEQATGYRGLYFVLQGRLSPLDGIGPRE
LGLERLSARLAEGEVSELIIATNPTVEGEATAHYLAQLARQAKVRPMRLAHGVPLGGELE
YVDRGTLSHAFGSRSEMG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcctcgctgctggaacaactgatcgacgcgctgcgcgtgctgcccggggtcggc
ggcaagagcgcccagcgcatggcctaccagctgctggagcgcgaccgcgacggcggccgg
cgcctgtccgccgcactggcccaggcgatggagcacgtcggccattgcgcgcagtgccgc
gacttcaccgaaggcccgctgtgcgccatctgcgccagcgccagccgcgaccggcaccag
ctgtgcgcggtggaaaccccggccgaccggttggcgatcgagcaagccaccggctatcgc
ggcctgtacttcgtcctgcagggccggctgtcgccgctggatggcatcggcccgcgcgag
ctggggctggagcgcctgtccgcgcgcctggccgaaggtgaggtcagcgagctgatcatc
gccaccaatcccaccgtggaaggcgaggccaccgcccattacctggcgcaactggcgcgc
caggccaaggtgcgcccgatgcgcctggcccacggcgtgccgctgggcggcgagctggaa
tatgtggaccgcggcacgctctcgcacgcattcggctcgcgcagcgagatgggctga

DBGET integrated database retrieval system