KEGG   Pseudoxanthomonas spadix: DSC_14570
Entry
DSC_14570         CDS       T01643                                 

Definition
(GenBank) protocatechuate 4,5-dioxygenase subunit beta
  KO
K15755  2'-aminobiphenyl-2,3-diol 1,2-dioxygenase, large subunit [EC:1.13.11.-]
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd00621  Dioxin degradation
psd01100  Metabolic pathways
psd01120  Microbial metabolism in diverse environments
psd01220  Degradation of aromatic compounds
Module
psd_M00544  Carbazole degradation, carbazole => 2-oxopent-4-enoate + anthranilate
Brite
KEGG Orthology (KO) [BR:psd00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    DSC_14570
Enzymes [BR:psd01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-  
     DSC_14570
SSDB
Motif
Pfam: LigB
Other DBs
NCBI-ProteinID: AER57558
UniProt: G7UUT5
Position
complement(2974454..2975260)
AA seq 268 aa
MANIVGVFVTSHVLFGDKSSDPQAGRVFAGLQELGRKAQECKPDLIVAISSDHMFNINLR
LQPPFTVGLSDSFTPFGDMDIPQTPRPGHRALAMQFCRDAAAAGFDLTQAEEYRPDHGIA
IPLMFLDPSSSIPILPLLVNINMDPAPTPGRCLALAQVLRRTLSALPGDQRIVVIGTGGL
SHWINIPGHGKVNSVFDQAVMDALANGAPELLADLSVEEILRDGGNGGLEIVNWMMAASM
LPGAKAVPVYYEAMPQWMTGMAGMAIAA
NT seq 807 nt   +upstreamnt  +downstreamnt
atggccaacatagttggtgtgttcgttacctcgcacgtcctattcggtgataagtcgtcg
gacccgcaggcgggccgcgtgttcgccggacttcaggaattgggccggaaggcgcaggag
tgcaagccagatctgatcgtggcgattagcagcgatcacatgttcaacattaacttgcgc
ctgcaaccgccctttaccgtgggcctgtcggatagcttcaccccgttcggcgacatggac
atcccgcagactccgcggcccggccatcgtgctcttgccatgcaattctgtcgcgatgcc
gccgcagccgggttcgacctgactcaggctgaggagtatcggccggatcatggcatagcc
atcccgctcatgttcctggacccttccagctcgatcccgatcctgccgctactggtgaac
atcaacatggatccggcgccaacgccgggccgatgtctcgcgcttgcccaagtcttgcgc
aggacgctgtctgctttaccaggcgatcagcggatcgtggtcattggcaccgggggattg
tcacactggatcaatatcccgggccacggcaaggtgaacagcgtgtttgaccaggccgtg
atggatgccttggccaatggcgcgcctgagctgttggcggacctatctgtcgaagagatt
ttgcgtgatggcgggaatggtgggctcgaaatcgtcaactggatgatggcagcgtccatg
ctgcccggcgcaaaggcggtaccggtctactacgaggccatgccgcaatggatgacggga
atggccggcatggcaatcgctgcctag

DBGET integrated database retrieval system