KEGG   Pseudoxanthomonas spadix: DSC_15400Help
Entry
DSC_15400         CDS       T01643                                 

Definition
(GenBank) pseudouridylate synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
psd  Pseudoxanthomonas spadix
Brite
KEGG Orthology (KO) [BR:psd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:psd03016]
    DSC_15400
Enzymes [BR:psd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     DSC_15400
Transfer RNA biogenesis [BR:psd03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    DSC_15400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AER57724
UniProt: G7UW66
Position
complement(3148950..3149660)
Genome map
AA seq 236 aa AA seqDB search
MPELTSIAILYQDDLLAVVDKPAGLMVHDSGLARGQDQFLAEHLRAQLGKPILLIHRLDR
GTSGCLLVAFDRDTASALGKAFMSRAVEKDYLAVCRGWPEQQFTIDHDLDGGPGRPARKQ
AITGFVRLATGELDIPSGGFETSRYALLRCRPHTGRFRQIRRHLKHAFHHLIGDTSHGEG
RHNRAFRMRGVQRMLLHARRLSFLHPATGVRIEALAPLDAEFARALDLFGWDHRLR
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaattgacctcgattgccatcctttatcaggacgatctgcttgccgtggtcgac
aagccggccgggctgatggtccatgacagtggcctggcgcgtggccaggaccagttcctg
gccgagcacctgcgcgcgcagctgggcaagccgatcttactgatccatcggctggaccgc
ggcaccagcggttgcctgctggtggccttcgaccgcgacacggcctcggcgctgggcaag
gccttcatgtcgcgcgccgttgagaaggattacctggccgtctgccgcggctggccggag
cagcagttcaccatcgaccacgacctggatggtgggcccggcaggccggccaggaagcag
gccatcaccggtttcgtgcgcctggccaccggcgagctggacatcccctcaggcggcttt
gagacctcgcgctatgcgttgctgcgctgccgcccgcacaccgggcgcttccgccagatc
cgtcggcatctcaagcatgccttccatcacctgatcggcgataccagccacggcgagggc
cggcacaaccgcgcgttccgcatgcgcggcgtacagcgcatgctgctgcatgcgcggcgg
ctgtcgttcctgcatccggccaccggcgtgcggatcgaggcgctggcgccgctggatgcc
gagttcgccagggcactggacctgttcggctgggaccaccggctgcgttag

DBGET integrated database retrieval system