KEGG   Pseudoxanthomonas spadix: DSC_15690Help
Entry
DSC_15690         CDS       T01643                                 

Definition
(GenBank) tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd00380  Tryptophan metabolism
psd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    DSC_15690
Enzymes [BR:psd01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     DSC_15690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase
Motif
Other DBs
NCBI-ProteinID: AER57782
UniProt: G7UWT5
Position
complement(3214193..3215074)
Genome map
AA seq 293 aa AA seqDB search
MAIFMQIQDNQRPLEAGIHTDLAGRTTYGGYLQLDRLLSAQQPLTVPAHHDEMLFIIQHQ
VSELWMKLMIHELCAALGHLQRDQVWQTRKVLARAKQVLRQLTEQWSVLETLTPSEYMGF
RDVLGPSSGFQSLQYRQLEFMLGNKNAAMLKVFSHDPAGQQVLRGALEAPSLYEEFLRYL
ARFGHAVPAQHLQRDFSLAHVRDEALLPMFERIYGDTDRYWREYALCEDLVDLETQFQLW
RFRHMRTVMRVIGFKRGTGGSSGVGFLKQALELEFFPELFQVRTVVGLEPPAG
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttggcgattttcatgcagatccaggacaaccagcggccgctggaagcaggcatccacacc
gacctggccggccgcaccacctacggcggttacctgcagctggaccggctgctgtcggcg
cagcagccgctgacggtgccggcccatcacgacgagatgctgttcatcatccagcaccag
gtgtccgagctgtggatgaagctgatgatccacgagctgtgcgccgcgctgggccacctg
cagcgcgaccaggtctggcagacccgcaaggtgctggcgcgggccaagcaggtgctgcgc
cagctgaccgagcagtggtcggtgctggagaccctgacgccttcggagtacatgggcttt
cgcgacgtgctggggccttcgtcggggttccagtcgctgcagtaccggcagctggaattc
atgctgggcaacaagaacgcggcgatgctcaaggtgttctcgcacgatcctgccggccag
caggtgctgcgcggggcgctggaggcaccgagcctgtacgaggagttcctgcgctacctg
gcccgcttcggccacgccgtgccggcccagcacctgcagcgtgacttcagcctggcgcat
gtgcgcgacgaggcgctgctgccgatgttcgaacgcatctacggcgacaccgaccgctac
tggcgcgagtacgcgctgtgcgaggacctggtcgatctggagacccagttccagctgtgg
cgctttcgccacatgcgcacggtgatgcgggtgatcggcttcaagcgcggcaccggcggc
tcctcgggcgtgggcttcctcaagcaggcgctggagctggagttcttcccggaactgttc
caggtccgcacggtggtggggctcgagccgcctgccgggtga

DBGET integrated database retrieval system