KEGG   Pseudogulbenkiania sp. NH8B: NH8B_0069Help
Entry
NH8B_0069         CDS       T01619                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
pse00430  Taurine and hypotaurine metabolism
pse00460  Cyanoamino acid metabolism
pse00480  Glutathione metabolism
pse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pse00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    NH8B_0069
   00460 Cyanoamino acid metabolism
    NH8B_0069
   00480 Glutathione metabolism
    NH8B_0069
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pse01002]
    NH8B_0069
Enzymes [BR:pse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     NH8B_0069
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     NH8B_0069
Peptidases and inhibitors [BR:pse01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   NH8B_0069
CD molecules [BR:pse04090]
 Proteins
  NH8B_0069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: BAK74918
UniProt: G2IUG1
Position
78758..80518
Genome map
AA seq 586 aa AA seqDB search
MLSSRIRRPFALGAMALGLALAFAPVASQAEAPVAAPVVKYDYDQDIFHPVYARHGMVAA
EQELASRIGLDVLKRGGNAVDAAVAVGFALAVVLPNAGNLGGGGFMVLHDAKSGQDVALD
FREIAPAKASRDMYLDEKGNVAEGRSTYTHLAVGVPGTVAGMEHALKRWGTMKLADLIAP
SIKLAEGGIVVSPTMAKMLEVEKDNLGKWDSTRAIFFKNGRPLQLGDKLVQKDLAKSLRL
IAKHGSKVFYSGEIGDKIVAEMAQHGGLIGKDDLRNYKVEERAPVRGEYRGYQVVSMPPP
SSGGTHIIQILNMLERYPLAQYGVNSAQTIHHMAEAMKLAYADRAEYLGDPGFVKVPVKG
LTSKKYADELAQKIDPVKVLPASAIKPGKPQPYESDQTTHYSIVDAKGNAVAVTYTLNLN
FGSGIVARGTGILLNDEMDDFSAKPGVPNAYGLIGGDANAIQPGKRPLSSMSPTLVLKNG
KPWLVTGSPGGARIITTTLQTIVNAIDFGMNPAEAASTPRVHHQWLPDVLRVEKGLSPDT
MAILQKQGYKVSVQPTMGRTQTIQLRDDGLYGYSDPRNPDGATLGY
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcttcccgtatccgtcgtcccttcgcgctcggcgccatggccttgggcctggcg
ctggcctttgccccggtcgcctcgcaagccgaagccccggtcgccgccccggtggtcaag
tacgactacgaccaggatatcttccaccccgtctacgccaggcatggcatggtcgccgcc
gagcaggagctggccagccgcatcggcctggacgtgttgaagcgcggcggcaacgccgtc
gacgccgcggtggcggtgggcttcgcgctggcggtggtgctgcccaacgccggcaacctc
ggcggcggcggcttcatggtgctgcacgacgccaagagcggccaggacgtggcgctcgac
ttccgcgagatcgccccggccaaggccagccgcgacatgtacctggacgagaagggcaac
gtcgccgagggccgctcgacctacacccacctcgccgtcggcgtgccgggcacggtggcc
ggcatggagcacgcgctcaagcgttggggcacgatgaagctggcggacctgatcgcgccg
tcgatcaagttggccgaaggcggcatcgtggtgagcccgaccatggccaagatgctggaa
gtggagaaggacaacctcggcaagtgggacagcacgcgcgccatcttcttcaagaacggc
cgcccgctgcagctgggcgacaagctggtgcagaaggacctggccaagtcgctcaggctg
atcgccaagcacggcagcaaggtcttttatagcggcgagatcggcgacaagatcgtggcc
gagatggcgcagcacggcggcctgatcggcaaggacgacctcaggaactacaaggtggaa
gagcgcgcgccggtgcgcggcgagtaccgtggctaccaggtggtgtcgatgccgccgccg
agctcgggcggcacccacatcatccagatcctcaacatgctggagcgctacccgctggcg
cagtacggcgtgaacagcgcgcagaccatccaccatatggcggaggccatgaaactggct
tatgccgaccgcgccgagtacctgggcgacccgggcttcgtcaaggtgccggtgaagggg
ctgacctcgaagaagtacgccgacgagctggcgcagaagatcgatccggtcaaggtgctg
ccggcctccgccatcaagccgggcaagccgcagccgtatgaaagcgaccagaccacgcac
tactcgatcgtcgacgccaagggcaacgcggtggcggtgacctacacgctgaacctgaac
ttcggcagcggcatcgtcgcccgtggcaccggcatcctgctcaacgacgagatggacgac
ttctccgccaagccgggcgtgcccaacgcctacggcctgatcggcggcgacgccaacgcc
atccagccgggcaagcgtccgctgtcgtcgatgtcgccgacgctggtgctgaagaacggc
aagccgtggctggtgaccggcagcccgggcggtgcgcgcatcatcaccaccacgctgcag
accatcgtcaacgccatcgacttcggtatgaacccggcggaggcggcgtcgacgccgcgc
gtgcaccaccagtggctgccggacgtgctgcgcgtcgagaagggcctgagcccggacacc
atggcgatcctgcagaagcagggctacaaggtgtcggtgcagccgaccatgggccgcacc
cagaccatccagctgcgcgacgacggcctgtacggctactccgacccgcgcaacccggac
ggcgccacgctcggctactga

DBGET integrated database retrieval system