KEGG   Pseudogulbenkiania sp. NH8B: NH8B_0096Help
Entry
NH8B_0096         CDS       T01619                                 

Definition
(GenBank) uroporphyrinogen-III synthase HemD
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
pse00860  Porphyrin and chlorophyll metabolism
pse01100  Metabolic pathways
pse01110  Biosynthesis of secondary metabolites
pse01120  Microbial metabolism in diverse environments
Module
pse_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NH8B_0096
Enzymes [BR:pse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     NH8B_0096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: BAK74945
UniProt: G2IUI8
Position
112489..113232
Genome map
AA seq 247 aa AA seqDB search
MSLAGRRILVTRPPAQSARLMALLSDAGAEPLPLPVLDIVPDERALAALPTLAEAADWLI
FVSPSAIDAAWPVLARRKLKLKARLACVGAASAAKLAALSGRAVLHPRDGSDSAALLALP
ELQRLAGQRVLIVRGVGGRAELGETLTARGARLTLAEVYRRVDGEPDWSLLEQPVDALVL
TSSDTAERLFRLAGRSRSLTLQCLLYCVPHPRIAATLAAHGVTRIVTTQADDAALVAGLS
EWFTRHP
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctggccgggcggcgcatcctcgtcacccggccgccggcgcagagcgcgcgcctg
atggcgctgctctctgacgccggcgccgagccgttgccgctgccggtgctcgacatcgtg
cccgacgagcgcgcgctggcggcgctgcccaccctggccgaggcggccgactggctgatc
ttcgtcagccccagcgccatcgacgccgcctggccggtgctggcgcggcgcaagctcaag
ctcaaggcccggctggcctgcgtcggcgccgccagtgccgccaagctggcggccctgtcc
ggccgcgccgtgctgcatccgcgcgacggcagcgacagcgccgcgctgttggcgctgccg
gaactgcagcgcctggccgggcaacgcgtgctcattgtgcgcggcgtcggcggccgggcg
gaactgggggagaccctcaccgcgcggggggcccgtctcaccctggccgaggtttaccgc
cgcgtcgacggggagcccgactggtccttgctggagcagccggtggacgccctggtgctg
acctccagcgataccgccgaacgattattccgactggctggccgctcccgtagcctgacg
ttacaatgcctgctgtactgcgttccgcatccgcgcattgccgccacgctggcggcgcac
ggcgtgacacgcatcgtgacaacccaggccgacgacgccgcactggtcgccggcctcagc
gaatggttcacccgtcacccatga

DBGET integrated database retrieval system