KEGG   Pseudogulbenkiania sp. NH8B: NH8B_0415Help
Entry
NH8B_0415         CDS       T01619                                 

Definition
(GenBank) hexapeptide repeat-containing transferase
  KO
K13018  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase [EC:2.3.1.201]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
pse00520  Amino sugar and nucleotide sugar metabolism
pse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NH8B_0415
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:pse01005]
    NH8B_0415
Enzymes [BR:pse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.201  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase
     NH8B_0415
Lipopolysaccharide biosynthesis proteins [BR:pse01005]
 Unusual sugar
  NH8B_0415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2 DZR
Motif
Other DBs
NCBI-ProteinID: BAK75255
UniProt: G2IWA0
Position
433604..434188
Genome map
AA seq 194 aa AA seqDB search
MREGTRMTYLVHPTSIVDDGATIGAGTRIWHWAHICAGAVIGERCSFGQNVFVGNDVIIG
NNVKVQNNVSIYDAVTLEDDVFCGPSMVFTNVNNPRSHVSRKHEYRRTVVKKGATIGANA
TVVCGHTIGEYAFIGAGAVVTHDVPAYALMVGAPAYRMGWMCACGERLSDMIGEHACPAC
GTNYDIGGNHCTPF
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtgagggcacccgcatgacctatctcgttcaccccacttccatcgtcgacgacggc
gccaccatcggcgccggcacccgcatctggcactgggcgcacatctgcgccggcgcggtg
atcggcgagcgctgctcgttcggccagaacgtgtttgtcggcaacgacgtcatcatcggc
aacaacgtcaaggtgcagaacaacgtgtcgatctacgacgcggtgacgctggaggacgac
gtgttctgcggcccctccatggtgttcaccaacgtcaacaacccgcgcagccacgtcagc
cgcaagcacgaataccgccgcaccgtggtgaagaagggcgccaccatcggcgccaacgcc
accgtcgtgtgcggccacaccatcggcgagtacgccttcatcggcgccggcgcggtggtg
acgcacgacgtgccggcctacgccctgatggtcggcgccccggcctaccgcatgggctgg
atgtgcgcctgcggcgagcgcctgtcggacatgatcggcgagcacgcctgcccggcctgc
ggcaccaactacgacatcggcggcaaccactgcacgccgttctga

DBGET integrated database retrieval system