KEGG   Pseudogulbenkiania sp. NH8B: NH8B_1015Help
Entry
NH8B_1015         CDS       T01619                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
pse00020  Citrate cycle (TCA cycle)
pse00640  Propanoate metabolism
pse00660  C5-Branched dibasic acid metabolism
pse01100  Metabolic pathways
pse01110  Biosynthesis of secondary metabolites
pse01120  Microbial metabolism in diverse environments
pse01130  Biosynthesis of antibiotics
pse01200  Carbon metabolism
Module
pse_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pse_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NH8B_1015
   00640 Propanoate metabolism
    NH8B_1015
   00660 C5-Branched dibasic acid metabolism
    NH8B_1015
Enzymes [BR:pse01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     NH8B_1015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: BAK75847
UniProt: G2IZP9
Position
1021864..1023033
Genome map
AA seq 389 aa AA seqDB search
MNLHEYQAKELLAKYGLPVQQGILAHSPEEAAAAYDKLGGKFAVVKAQVHAGGRGKAGGV
KVVKSREEAAEVAKTLIGTNLVTYQTDAAGQPVNSVLVCEDMYPVQRELYLGAVVDRGSQ
RVVFMVSTEGGVEIEKVAEETPEKIIKVEVNPLVGMQPFQARDCAFALGLSGKQVGEFTK
LMLGAYEAFVANDFALFEVNPLALRENGELACVDGKINLDSNALYRHPELLAQRDKSQEN
EREVKASEFDLNYVALEGNIGCMVNGAGLAMATMDIIKLKGGQPANFLDVGGGATKERVI
EAFKLILADTSVKGVLINIFGGIVRCDMIAEAIIAAVKEVNVTVPVVVRLEGNNAELGAK
ILDESGLKLTSAQGLNDAAEKIVAAVAAL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgcacgaataccaagcgaaagagctgctggccaagtacggcctgccggtgcaa
caaggcattctggctcactcgccggaagaagccgccgctgcttacgacaagctgggtggc
aagtttgccgttgtgaaggcccaggtccacgccggtggccgtggcaaggccggtggcgtg
aaagtggtgaagagccgcgaagaagccgccgaagtcgccaagacgctgatcggcaccaat
ctggtgacctatcagaccgacgcggccggtcagccggtcaacagcgtgctggtgtgcgaa
gacatgtacccggtacagcgcgaactgtacctgggcgccgtggttgaccgcggttcccag
cgcgtggtgttcatggtgtccaccgaaggcggcgtggaaatcgagaaggtcgccgaagaa
accccggaaaagatcatcaaggtcgaagtgaacccgctggtcggcatgcagccgttccag
gcacgcgactgcgcgtttgccctgggcctctccggcaagcaggttggcgaattcaccaag
ctgatgctgggcgcctacgaagccttcgtcgccaacgacttcgcgctgttcgaagtgaac
ccgctggcgctgcgtgaaaacggcgaactggcttgcgtcgacggcaagatcaacctcgac
tccaacgccctgtaccgtcacccggaactgctggcccagcgcgacaagtcgcaggaaaac
gaacgcgaagtgaaggcttccgagttcgacctgaactatgtggcccttgaaggcaacatc
ggctgcatggtgaacggtgccggtctggcgatggccaccatggacatcatcaagctgaag
ggcggccagccggccaacttcctggacgtgggcggtggcgccaccaaggagcgcgtgatc
gaggcgttcaagctgatcctggccgatacctcggtgaagggcgtgctgatcaacatcttc
ggcggtatcgtgcgttgcgacatgattgccgaggcgatcattgctgctgtgaaggaagtg
aacgtgaccgtgccggtcgttgtgcgcctggaaggcaacaacgccgagctgggcgccaag
atcctggacgaatccggtctgaagctgacctccgcccagggcctgaacgacgcagccgag
aagatcgttgctgctgtcgccgccctctaa

DBGET integrated database retrieval system