KEGG   Pseudogulbenkiania sp. NH8B: NH8B_1069Help
Entry
NH8B_1069         CDS       T01619                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
pse00450  Selenocompound metabolism
pse00970  Aminoacyl-tRNA biosynthesis
pse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pse00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    NH8B_1069
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NH8B_1069
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pse01007]
    NH8B_1069
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pse03016]
    NH8B_1069
Enzymes [BR:pse01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     NH8B_1069
Amino acid related enzymes [BR:pse01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   NH8B_1069
Transfer RNA biogenesis [BR:pse03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    NH8B_1069
 Prokaryotic type
   Other AARSs
    NH8B_1069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 DALR_1
Motif
Other DBs
NCBI-ProteinID: BAK75900
UniProt: G2IZV2
Position
1088075..1090183
Genome map
AA seq 702 aa AA seqDB search
MTSPRKILVTSALPYANGAIHLGHMVEHIQTDVWVRFQKMRGHACHYVCADDTHGTPIML
AAEKQGITPEQLIERVKAEHLADFTGFHIGYDNYYSTNSPENKHFAEHIYRTLRANGKIV
SRTIEQLFDPEKQMFLPDRFVKGECPKCGAKDQYGDNCESCGATYSPTDLKNPYSAVSGA
TPVLKSSEHYFFRLGDCADFLKAWTAGSSVRADGETQPHLQPESLNKMNEWIEGGLHDWD
ISRDAPYFGFEIPDAPGKYFYVWLDAPIGYMASFKNLCEKSGLDFDDYFRPDSDAELYHF
IGKDILYFHALFWPAMLKYSGYRAPTGVFAHGFLTVDGQKMSKSRGTFITAKSYLDCGLN
PEWMRYYVAAKLNARIEDIDLSLDDFVARVNSDLIGKFVNIASRAAGFITKRFGGRLAES
VSSSALASPVCHAAQCEHPLLQQLAESSATLAAAYEAREYARALRDVMALADEVNAYVDA
NKPWELAKQEGMEARLHEVCTVLVNAFRLLAIYLKPVLPKLAADVEAFLNIAPLTWDDAD
TLLLGHTIKPYQHLMQRVEAAQIDKLIEANKQSMEQQAAPAEASANYEPLADTITIDDFA
KLDLRVGKVLACQFVDGSDKLLQFTVDLGFETRNIFSGIRQAYQEPDKLVGRNVIVVANL
APRKMRFGVSAGMIVCASGNDDTSGLFLLDTDDGAQPGMRIG
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgacctccccacgcaagattctggtgaccagcgccctgccgtacgccaacggcgcgatt
cacctcggccacatggtcgaacacatccagaccgacgtctgggtgcgcttccagaaaatg
cgcggccacgcctgccattacgtctgtgccgacgacacccacggcacgccgatcatgctc
gccgccgagaagcagggcatcacgcccgagcagctgatcgagcgcgtcaaggccgagcac
ctggccgatttcaccggcttccacatcggctacgacaactactacagcaccaacagcccg
gaaaacaagcacttcgccgagcacatctaccgcacgctgcgcgccaacggcaagatcgtg
tcgcgcaccatcgagcagctgttcgatccggaaaagcagatgttcctgccggaccgcttc
gtcaagggcgagtgccccaagtgcggcgccaaggaccagtacggcgacaactgcgagagc
tgcggcgccacctacagcccgaccgatctgaaaaatccgtactcggcggtgtccggtgcc
accccggtgctgaaatcgtccgagcattacttcttccgcctgggcgattgcgccgatttc
ctcaaggcctggaccgccggttccagcgtgcgcgccgatggcgaaacccagccgcatctg
cagcctgaatccctcaacaagatgaacgagtggatcgagggcggcctgcacgactgggac
atcagccgcgacgccccgtacttcggcttcgagattcccgacgcaccgggcaagtacttt
tacgtctggctcgacgccccgatcggctacatggcgagcttcaagaacctgtgcgagaag
agcggtctggatttcgacgactacttccgcccggattccgacgccgagctgtaccacttc
atcggcaaggacatcttgtacttccacgccctgttctggccggcgatgctgaagtactcc
ggctaccgcgccccgaccggtgtgttcgcccacggcttcctcaccgtggacgggcagaag
atgtccaagtcgcgcggcaccttcatcaccgccaagagctacctcgactgcggcttgaac
ccggaatggatgcgctactacgtcgccgccaagctgaacgcccgcatcgaggacatcgac
ctgtcgctcgacgatttcgtggcgcgcgtcaactccgacctgatcggcaagttcgtcaac
atcgccagccgcgccgccggcttcatcaccaagcgttttggcggtcgtctggcggagagc
gtatccagctccgcgctggcgagcccggtgtgccatgccgcgcagtgcgaacacccgttg
ctgcagcagttggccgaaagcagcgcgacgctggccgcggcttacgaggcgcgtgaatac
gcccgcgcgctgcgcgacgtgatggcgctggccgacgaggtcaatgcctacgtcgacgcc
aacaagccgtgggaactcgccaaacaggaagggatggaagcgcgcctgcacgaagtctgt
accgtgctggtgaacgccttccgcctgttggccatctacctcaagccggtgttgccgaag
ctggcggccgacgtcgaggccttcctcaacatcgccccgctcacgtgggacgacgccgac
accctgctgctcggccacaccatcaaaccgtatcagcatctgatgcagcgcgtcgaggcg
gctcagatcgacaaactgatcgaagcgaacaaacaaagcatggaacaacaagctgcccct
gccgaggcttcggccaactatgagccgctcgccgacaccatcaccatcgacgacttcgcc
aagctcgacctgcgcgtcggcaaggtgctggcctgccagttcgtcgatggttcggacaag
ctgctgcaattcaccgtcgacctcggtttcgagacgcgcaacatcttctccggcatccgc
caggcctaccaggagcccgacaagctggtcggccgcaacgtcatcgtggtggccaacctg
gcgccgcgcaagatgcgcttcggggtgtcggccggcatgatcgtctgcgcctccggcaac
gacgacacgagcgggttgttcctgctcgataccgacgatggcgcccagccggggatgcgc
atcggctaa

DBGET integrated database retrieval system