KEGG   Pseudogulbenkiania sp. NH8B: NH8B_1113
Entry
NH8B_1113         CDS       T01619                                 

Gene name
impC
Definition
(GenBank) type VI secretion protein EvpB/ImpC
  KO
K11900  type VI secretion system protein ImpC
Organism
pse  Pseudogulbenkiania sp. NH8B
Brite
KEGG Orthology (KO) [BR:pse00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pse02044]
    NH8B_1113 (impC)
Secretion system [BR:pse02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   NH8B_1113 (impC)
SSDB
Motif
Pfam: VipB VipB_2 DUF3386
Other DBs
NCBI-ProteinID: BAK75943
UniProt: G2IZZ5
Position
complement(1135340..1136824)
AA seq 494 aa
MNSVQQLDTAASPNVVDAGSLLDSIIEQSRIATNDSEKNHTRDLIGELVAQVLEGCVTVS
RDLSASIDARIAELDALLSSQLNEVMHHPEFQKLEASWRGLKYLVAESETSTMLKIKVLN
ASKKDLVKDFKASPEFDQSALFKKIYEEEYGTFGGAPYAALVGDYEFTRHPEDFYLLDEL
SHVAASAHAPLISSASPGLFGLESFTDIGKPRDLAKIFDTVEYAKWKSFRESEDSRYVGL
VLPHVLGRLPYGRDNVPVEAFDFEENVDGSHHGKYLWTNAAYAYAARLTDAFAQYGWLAA
IRGVEGGGLVEGLPAHTFKTDDGEVALKCPTEVAVTDRTEKLLSDLGFISLVHCKNTDYA
AFFSGQSVQKAKTYNTDAANANARLSTQLPYIFAVSRIAHYMKSIMRDKIGSFASRQNVQ
DFLNTWLAQYVLLDDSASQEAKAKYPLREARVDVVEVPGKPGVYRAAAFLRPHFQLDELT
ISLRLVAELPQPAG
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgaacagcgtacaacaactggacacggcggcgagcccgaatgtcgtcgatgccggtagt
ctgctggacagcatcatcgagcagagccgcatcgccaccaacgacagcgaaaaaaaccat
acccgcgacctgatcggcgaactggtggcccaggtgctggaaggctgcgtgaccgtatcg
cgcgatctgtccgccagcattgatgcccgcatcgccgagctggacgccctgctgtcgtcc
cagctcaacgaggtgatgcaccaccccgagttccagaagctggaagcctcgtggcgcggc
ctcaagtatctggtggcggaatcggaaaccagcaccatgctgaagatcaaggtgctcaat
gcctccaagaaggatctggtgaaggacttcaaggcctcgccggagttcgatcagagcgcc
ttgttcaagaagatctacgaggaagagtacggcaccttcggtggcgcaccctacgccgcc
ctggtgggcgactacgaattcacccgccacccggaagacttctacctgctggatgagctg
tcccatgttgcagcctcggcgcatgccccactgatctcctccgcctcccccggcctgttc
ggcttggaaagctttaccgacattggcaaaccacgcgatctggccaagatcttcgacacc
gtggaatacgccaagtggaagtctttccgcgaatccgaagattcgcgctacgtcggcctg
gtactgccgcatgtgctcggccgcctgccatatggccgcgacaacgtgccggtagaagca
ttcgactttgaagaaaacgtcgacggcagccatcacggcaaatacctgtggaccaacgct
gcttatgcctacgccgcacgcctgaccgatgccttcgcccagtacggctggctggcggcg
atccgtggtgtggaaggcggtggcctggttgaaggactgcccgcacacaccttcaagacc
gatgacggcgaggtggcgctcaagtgccccaccgaagtggccgtcaccgatcgcaccgaa
aagctgctgtcggaccttggcttcatctcgctggtgcactgcaaaaacaccgactacgcc
gccttcttcagcggccaatcggtgcagaaagccaagacctacaacaccgatgcggccaac
gccaacgcacgcctctccactcagctgccctacatcttcgccgtatcgcgcattgcgcat
tacatgaaatccatcatgcgcgacaagatcggcagctttgcctcacgccaaaacgtgcag
gacttcctgaacacctggttggcgcagtacgtgttgctggacgactccgccagccaggaa
gccaaggctaaatacccgctgcgggaggcccgtgtagacgtggtggaagtccctggcaag
ccgggcgtctatcgcgccgcggccttcctgcgcccgcatttccagctggatgaactcacc
atttccctgcgtttggttgccgagctgcctcagccggcaggctaa

DBGET integrated database retrieval system