KEGG   Pseudogulbenkiania sp. NH8B: NH8B_1118
Entry
NH8B_1118         CDS       T01619                                 

Gene name
lip
Definition
(GenBank) type VI secretion lipoprotein, Lip family
  KO
K11906  type VI secretion system protein VasD
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
pse03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pse00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    NH8B_1118 (lip)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pse02044]
    NH8B_1118 (lip)
Secretion system [BR:pse02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   NH8B_1118 (lip)
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: BAK75948
UniProt: G2J000
Position
1143417..1143953
AA seq 178 aa
MQHCKAGLWRHARGFLGGLVPAVLLISGCASNKEVQVSGEAAAQLNRDGRGKPLSVVVRV
YQLKSDQAFNRLSMEALATAKSDKELLASELLDMREMTLLPGTRVTVSGFVVNPEASHIG
LVALFRQPDRHFWRLLYDADVVRSKGLQFAAEDCYLRAVKPPPKLLPGQPKSLQVDCR
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcagcattgcaaggccgggttgtggcgtcatgccagggggtttctgggggggctggtg
cctgccgtattgctcatatccgggtgtgcttcgaacaaggaagtacaagtgtccggcgaa
gccgctgcgcagctgaaccgcgatggtcgcggcaagcctctgtcggtcgtggtgcgggtc
tatcagctgaagtcggatcaggcgttcaaccgcttgagcatggaggcgctggcgactgcc
aagtcggacaaggagttgctggcatccgaactgctcgacatgcgcgagatgacgctgctg
ccgggtacgcgcgttacggtgtccggtttcgtggtgaaccccgaggcctcgcacattggc
ctggtggccctgttccgccagccggaccggcatttctggcgcttgctgtacgacgccgat
gtcgtgcgcagcaaggggctgcagttcgcggcggaagactgttacctgcgtgccgtcaag
cctccgccaaagctgttgccggggcagcccaagtcgctgcaggtcgattgccgctag

DBGET integrated database retrieval system