KEGG   Pseudogulbenkiania sp. NH8B: NH8B_1121Help
Entry
NH8B_1121         CDS       T01619                                 

Gene name
impF
Definition
(GenBank) type VI secretion system lysozyme-related protein
  KO
K11897  type VI secretion system protein ImpF
Organism
pse  Pseudogulbenkiania sp. NH8B
Brite
KEGG Orthology (KO) [BR:pse00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pse02044]
    NH8B_1121 (impF)
Secretion system [BR:pse02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   NH8B_1121 (impF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25
Motif
Other DBs
NCBI-ProteinID: BAK75951
UniProt: G2J003
Position
1146093..1146578
Genome map
AA seq 161 aa AA seqDB search
MNAPSLRHTQILPSVLDRLLDDQPDLSHGTEHLLFELPQFRRALARDLEALLNTRVMAQP
ELFEAHTLAGDSMLQFGIPDLSGISLLNPDDRELLREQLRRAIEIHEPRLSRVRVNLDAP
RERERHLRFRVDAVLKVHPHRPPVSFDATLQLSSNVYKVQG
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccccctcactgcggcatacccagatactgccttcggtgttggatcgtctgctg
gacgaccagcccgatctcagccatgggaccgagcacctgctgttcgagctgcctcagttc
cgccgtgcgctggcgcgcgatctcgaagcgctgctcaatacccgcgtcatggcgcagcct
gaactgttcgaggctcataccctggcgggggacagcatgctgcaattcggcattcccgac
ctgagcggcatcagcctgctgaatcccgacgaccgcgaactgttacgtgagcaactgcgt
cgcgccattgaaatccacgaaccgcgtttgtcccgcgtcagggtgaatctggatgcgccg
agggaaagggagcggcacctgcgtttccgtgtcgatgcggtactgaaagtacacccgcac
cgtccccccgtgagctttgacgccacgctgcaactgtcgtccaacgtttacaaggttcag
ggctga

DBGET integrated database retrieval system