KEGG   Pseudogulbenkiania sp. NH8B: NH8B_1129
Entry
NH8B_1129         CDS       T01619                                 

Gene name
impG
Definition
(GenBank) type VI secretion protein ImpG
  KO
K11896  type VI secretion system protein ImpG
Organism
pse  Pseudogulbenkiania sp. NH8B
Brite
KEGG Orthology (KO) [BR:pse00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pse02044]
    NH8B_1129 (impG)
Secretion system [BR:pse02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   NH8B_1129 (impG)
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: BAK75959
UniProt: G2J011
Position
1154392..1156248
AA seq 618 aa
MLESLLPYYERELGHLRELSGEFARRYPKIAGRLQLEGDQCEDPHTERLIEAFAFLAARV
HKKLDDDYPEVATSFLDVMYPHYLQPMPAATVVQFECDTQRPEIGKRYRIERGQQVLAPA
IQGVNCKFRSVYPVDLYPLQLQEARLELTSGSPYLRSLAPDAAAVLTLKLQTQGGVLLNA
IDLQSLRFFLDGEPALMHLLYELLLSSVLRVQVGDGSEDPARTRMLAADSLQAVGFGADE
GMLEYDERSFLGYRLLSEYFSYPDKFLFIDLLNLAPLVARLQGDTLLLRIQLRDYPDSER
HHRLQSQLQPAHLKLGCAPLINLFTQPGEPIRVTHQKSSYPVLADARKQQAYEVVQIRRV
VRVEKSGEGDSSEEVPPFYATRHGSGQAPRFYWHATREPSVRQGDRGTDMALHLVDLQFD
AVRPAGEVLSLDLLCSNRDLPEQIPFGGSQATQRTDFQLPGHSVVKRVRLLRKPGASQRS
PLGRAVQWRLISHLSLNYMSIVDSGREALQEMLTLYNLGDAAANVRQIQGIVGIRSEPAV
QRVNGRHFSGFVRGTEITLTLDADYYVGGSVYLFASLLERFFALYCAPNSFTRLRVRTVQ
RDEEVAAWPARAGEALVI
NT seq 1857 nt   +upstreamnt  +downstreamnt
atgctcgaatccctccttccctattacgaacgcgagctcggccatctgcgcgagctgtcg
ggtgagttcgcccgccgttaccccaagattgccggccgcttgcagctggaaggcgaccag
tgcgaagacccgcataccgagcggctgatcgaggcgtttgcctttctggcggcgcgggtg
cacaagaagctggatgacgactacccggaggtggccaccagctttctggatgtgatgtac
ccgcactatctgcagccgatgccggcggccaccgtggtgcagttcgaatgcgatacgcag
cggccggagatcggcaagcgctaccgtatcgagcgcgggcagcaggtgctggcgccggcc
atccagggggtgaactgcaagtttcgcagcgtctacccggtggacttgtacccgctgcag
ctgcaggaggcccggctggagctgaccagcggctctccctacctgcgcagcctggcgccg
gatgcggcggcggtgctgacgctgaagctgcagacccagggcggggtgttgctgaatgcc
atcgatttgcagtcgctgcgctttttcctggacggtgagccggcgctaatgcacctgctg
tacgagctgttgctatccagcgtgctgcgggtgcaggtgggggatggcagcgaagacccg
gcacgtacgcgcatgttggccgcagacagcctgcaggcggtcggctttggtgcggatgaa
ggcatgctggagtacgacgagcgctccttcctgggctaccgtttgctgtcggaatacttc
agctacccggacaaattcctgttcatcgacctgctgaacctggcgccgctggtggcccgg
ctgcagggcgacacgctgctgctgcgcatccagctgcgcgactacccggacagtgagcgc
caccaccggctgcaaagccagctgcagccggcgcacctcaagctgggctgcgcgccgctg
atcaacctgtttacccagccgggcgagccaatccgcgtgacgcaccagaaaagcagctac
ccggtgctggccgacgcgcgcaagcagcaggcctacgaggtggtgcagatccgccgcgtg
gtgcgggtggaaaaatccggcgagggcgacagcagcgaggaagtgccaccgttctacgcc
acccggcacggcagcggccaggcgccgcgcttctactggcatgccacccgcgagccatcg
gtgcgccagggcgaccgtggcaccgacatggcgttgcacctggtggatttgcagttcgac
gcggtacgcccggccggcgaggtgctgagtctggacttgctgtgcagcaaccgcgatctg
ccggagcagattcccttcggcggcagccaggccacccagcgcacggatttccagttgccg
gggcattcggtggtgaagcgggtgcgcttgttgcgcaagcccggcgccagccagcgcagt
ccgctggggcgggcggtgcagtggcgcctgatctcgcacctgtcgctcaattacatgtct
atcgtcgattccggacgcgaggcgctgcaggaaatgctgacgctgtacaacctgggcgat
gcggcggccaatgtacggcagatccagggcattgtcggcatccgcagcgaaccggcggta
cagcgcgtcaacggccggcatttctccggtttcgtgcgcggtaccgagatcaccctgacg
ctggatgccgattactacgtcggcggcagcgtctacctgttcgcctccctgctggagcgg
ttcttcgcgctgtactgcgcccccaacagttttacccgtctgcgtgtcaggacggtgcaa
cgtgacgaggaggtggcggcatggccagcccgagccggcgaagccctcgtgatctga

DBGET integrated database retrieval system