KEGG   Pseudogulbenkiania sp. NH8B: NH8B_1130
Entry
NH8B_1130         CDS       T01619                                 

Gene name
impH
Definition
(GenBank) type VI secretion protein ImpH
  KO
K11895  type VI secretion system protein ImpH
Organism
pse  Pseudogulbenkiania sp. NH8B
Brite
KEGG Orthology (KO) [BR:pse00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pse02044]
    NH8B_1130 (impH)
Secretion system [BR:pse02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   NH8B_1130 (impH)
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: BAK75960
UniProt: G2J012
Position
1156212..1157228
AA seq 338 aa
MASPSRRSPRDLKLALARDASQFGFFQAVRLLGLCEGARRQRRTLPAQLRFRTLASLSFP
ASELVQYQPAAEEGTAPAEMTVSFMGLTGPSGVLPTAYTELLLERRQQYRDTTLHSFLDL
FSHRAIALFYAAWRKYRFWLAEEAGEQDGFSRNLLDLAGVGLSRLRGQAAQDGLLNERLF
IYYAGLLSQKPLSALTLQTLVEGLFGARAQLQQFAGLWLEVPLAEQSQLGGQSCELGVSL
FAGERQWDRQTKLQLRLGCLRRAQFEALLPGGDGARALQALMQFAVGHQLAVDVCLVLDK
HDVPPARLDADAPLRLGASSWLGARAADPDDVRYALLH
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggccagcccgagccggcgaagccctcgtgatctgaagctggcgctggccagggatgcc
agccagttcggctttttccaggcggtgcgcctcctaggcttgtgtgagggcgcgcgtcgc
cagcggcgcacgctgccggctcaactgcgcttccgcaccctggcgtcgctgtcgtttcca
gccagcgagctggtgcagtaccagccagcggcggaggagggcacggcgcccgccgagatg
acggtcagcttcatggggctgaccgggcccagcggggtgttgccgacggcgtataccgag
ctcttgctagagcggcggcagcaataccgcgacaccactcttcattcctttctcgatctg
ttcagccaccgcgccatcgccttgttctacgcggcctggcgcaagtaccgcttctggctg
gccgaggaggccggcgagcaggatggcttcagccgcaacctgctggatctggccggggtc
ggtttgagccggttgcgtgggcaggcggcgcaggacggcctgctgaatgagcggctgttc
atttattacgcaggcctgttgagccagaagccgctgtcggccctgacgctgcagaccttg
gtggaggggctgttcggcgcccgtgcccagttgcagcagttcgcggggctgtggctggag
gtgccgttggctgagcaaagccagctgggtggccagtcctgcgaactgggggtgtcgctg
ttcgccggcgagcggcagtgggatcgccagaccaagctgcaactgcgcctggggtgtttg
cgtcgtgcgcaattcgaggccttgctgccggggggagatggagctcgcgccttgcaagcg
ctgatgcagtttgccgtggggcaccaactggcggtggatgtctgcctggtgctcgacaag
cacgatgtgccgccggcacggctggatgcagatgccccattgcggctgggggccagcagt
tggctgggggcgcgggcagccgacccggacgacgtgcgctatgcgctgttgcactga

DBGET integrated database retrieval system