KEGG   Pseudogulbenkiania sp. NH8B: NH8B_1134Help
Entry
NH8B_1134         CDS       T01619                                 

Gene name
impA
Definition
(GenBank) ImpA-like N-terminal family protein
  KO
K11902  type VI secretion system protein ImpA
Organism
pse  Pseudogulbenkiania sp. NH8B
Brite
KEGG Orthology (KO) [BR:pse00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pse02044]
    NH8B_1134 (impA)
Secretion system [BR:pse02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   NH8B_1134 (impA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImpA_N
Motif
Other DBs
NCBI-ProteinID: BAK75964
UniProt: G2J0H5
Position
1161657..1162754
Genome map
AA seq 365 aa AA seqDB search
MQNPSVALLLAPLPGGHPAGEDLAYSPLFDQIREARRSDDPLLSQGDWEQALKVAEWPKV
IRLCEEALSLRSKDLQLLVWYAEAQVQVHGLASLAQGLAALADWLEHYWESGYPEFDPHD
LDERVGKLEWLNLQLGVAIRSSPLVKPEHGGYSWQQWRQSREVDNLALKDPEAKLAALAE
GKLAGEDFDKGAALSGHAWFASQAELLLASLSAYEALDKRLDERFGDEAPSLAEVRNAIY
ACQELVLRYRQQLGGAAVVATPSAPPSHTALPENTAMPSAIPTTPAVTAPAPTFDGQVSS
RQQAVQMLAEVARYFRHNEPHSPVALLAERAARWAEMSLEEWLQHVVKDDSTLRQLQELL
DINHS
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacccttctgttgcgcttttgctggcccccttgccgggcggtcatcccgccggg
gaagacctggcttattcccccttgttcgaccagatccgcgaggcccggcgcagcgatgat
ccgttgctgtcccaaggcgactgggagcaggctttgaaagtggccgaatggcccaaggtg
atccgcctgtgcgaggaggccctgagcctgcgcagcaaggatttgcagctgctggtttgg
tatgccgaagcccaagtgcaggtacatggcctggccagcctggcgcaggggctggccgcc
ttggccgactggctggagcattactgggagagcggctacccggagttcgacccgcatgat
ctggatgagcgggtaggcaagctggagtggctcaacctgcaactcggcgtggctatccgc
agtagcccactcgtcaagcccgagcatggcggttacagctggcagcagtggaggcagtcc
cgcgaggtggataatctggccctgaaagatccggaggcgaaactggcggcgttggccgag
ggaaagcttgccggcgaggacttcgataagggggctgccttgtcgggtcatgcctggttc
gccagccaggccgagctgctgttggcgtcgctgagtgcctacgaggcattggacaagcga
ctcgatgagcgtttcggcgatgaagcgccgagccttgccgaggtgcgcaacgccatttac
gcctgccaggagctggtgctgcgttaccgccagcaactgggcggcgctgcggtggtcgct
acacccagcgcgccaccttcccataccgcgctgccggagaacaccgccatgccttctgcc
attccgacaactccagcagtgacggcaccggcgcccactttcgacggccaagtcagtagc
cgccagcaggcggtacagatgttggccgaggtcgcccgttactttcgtcacaacgaaccg
cacagcccggtggcgttgctggccgagcgtgctgcacgctgggcggaaatgagcctggaa
gaatggctgcagcatgtggtgaaggatgactcgacactgcgccagttgcaggagctgctg
gatatcaaccacagctga

DBGET integrated database retrieval system