KEGG   Pseudogulbenkiania sp. NH8B: NH8B_1178Help
Entry
NH8B_1178         CDS       T01619                                 

Definition
(GenBank) oxidoreductase FAD/NAD(P)-binding domain protein
Organism
pse  Pseudogulbenkiania sp. NH8B
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_1 Fer2 FAD_binding_6 FAD_binding_8 NAD_binding_6
Motif
Other DBs
NCBI-ProteinID: BAK76004
UniProt: G2J0L5
Position
1203238..1204338
Genome map
AA seq 366 aa AA seqDB search
MARIELKDWPIPLENGGETVLETMIAHGVPFPYSCASGDCGACKGRVLCGEVAHDSAPAG
ILSATERADGYVLACRCTPKSDLRIEALDELVALPAARRQRGWVVSRQHRQGDVVVLRVK
PAKPVHYLAGQFFYLKFDNLPQRAYSVASLPGADELEFHVRLVEGGKTSRYVSRDNLVGS
EVTVDGPHGHGYWRQNHDGPIVAIGGGTGLAPVLSIIGAALAANAHRHVHLYYAARVEAD
VYWEAELAALARQYPNLRVDCALSRAEPSEQGPLPRRYQRVTASLEQDWPSLAGAKLYIA
GPPKMVEAVAVTARELGLAARDLHTDPFSDAADHKLDGACTSWLRRFVGRWRRPPFELPG
LATQKG
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtatcgaactcaaggactggcccatcccgctggagaacggcggcgaaaccgta
ctggaaaccatgattgcccatggggtgccgtttccctactcctgcgccagcggtgactgc
ggcgcgtgcaagggccgggtgctgtgtggcgaggtcgcgcacgacagcgcccccgccggc
atcctctccgccaccgagcgtgccgacggctacgtactcgcctgccgctgcacgcccaag
agcgacctgcgcatcgaggcgctggacgaactggtcgcgttgcccgcggcgcggcgccag
cgtggctgggtcgtctcccggcaacaccgtcagggcgacgtggtggtgctgcgggtgaag
cctgccaaaccggtgcactaccttgccgggcagttcttctatctgaaattcgacaacctg
ccgcagcgcgcgtactcggttgcctcgctacccggcgccgacgagctggaattccacgtc
cgcttggtggaagggggcaaaacctcccgctacgtgagccgtgacaacctggtcggcagt
gaggtcacggtcgacggcccgcacggccacggctactggcgccagaaccacgacggcccg
attgttgccatcggcggcggtaccgggctggcaccggtgttgtccatcatcggcgccgcg
ctcgccgcgaacgcgcaccgccacgtgcacctgtactacgcggcacgcgtggaagcggat
gtgtactgggaagccgaacttgccgcgctcgcgcgccagtacccaaacctgcgcgtggac
tgtgcgctgtcacgtgccgagccgtcggagcaggggccgttgccgcgccgctaccagcgc
gtgaccgcaagcctcgaacaggactggcccagtcttgccggcgccaagctttacatcgcg
ggcccgccgaagatggtcgaggcggtcgccgtcaccgcgcgcgaactggggctcgccgca
cgggatctgcacaccgacccgttctcggatgccgccgaccacaagctcgacggggcatgc
accagttggctgcgccgctttgtcgggcgctggcgccgcccgccgttcgagctaccaggc
ttggcaacgcagaaggggtga

DBGET integrated database retrieval system