KEGG   Pseudogulbenkiania sp. NH8B: NH8B_1502Help
Entry
NH8B_1502         CDS       T01619                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
pse00260  Glycine, serine and threonine metabolism
pse00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pse01100  Metabolic pathways
pse01110  Biosynthesis of secondary metabolites
pse01130  Biosynthesis of antibiotics
pse01230  Biosynthesis of amino acids
Module
pse_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NH8B_1502
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NH8B_1502
Enzymes [BR:pse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NH8B_1502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB Ribul_P_3_epim IMPDH
Motif
Other DBs
NCBI-ProteinID: BAK76324
UniProt: G2J2E8
Position
1564192..1564980
Genome map
AA seq 262 aa AA seqDB search
MSRIAACFAALAGKKALIPFITAGDPHPDLTVSLMHGLVEGGADIIELGVPFSDPMADGP
VIQRASERALAHKVGLRHVLDMVAEFRKTNSTTPVVLMGYLNPLCAMGYAEFAKRAAAAG
VDGMLTVDCPPEEAEELATALQQESIDPIFLLAPTTPLQRVAEIARHARGYVYYVSLKGV
TGAGNLDIDDVARKIAALRQYIHVPIGVGFGIRDGATARAIAVTADAVVVGSRLVQEIEA
ATPATARERLTPLVAELKAAIS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtattgcagcatgttttgccgcactggccggcaagaaggccctgattccgttc
attaccgcgggtgatcctcatccggatctgaccgtgagcctgatgcatggcctggtcgag
ggcggcgccgacatcatcgagctgggggtgccgttttccgatccgatggccgacggtccg
gtgattcaaagagcctccgagcgcgcgctggcacacaaggtcggcctgcgccatgtgctc
gacatggtcgccgagttccgcaagaccaacagcaccacgccggtggtgctgatgggttac
ctgaatccgctgtgtgccatgggctatgctgaatttgccaagcgtgccgccgccgccggg
gtggacggtatgttgacggtcgattgcccgccggaagaggcggaggaactggccacggcg
ctgcaacaggaaagtatcgacccgatcttcctgttggcgccgaccacaccgctccagcgg
gtggccgagatcgctcgtcatgcgcgcggctatgtttactatgtgtcactgaaaggcgtg
accggtgctggaaatctggacattgacgacgtagcgcgtaaaattgccgcccttagacaa
tacattcatgtgcctatcggtgtcggcttcggtattcgcgacggtgcaaccgcgcgtgcc
attgccgtcacggccgatgctgtcgtggtgggaagccgtctggtccaggaaatcgaggcg
gcaacgcccgcgaccgctcgcgagcggttgacgcccctggtcgccgaactgaaggccgcc
attagttag

DBGET integrated database retrieval system