KEGG   Pseudogulbenkiania sp. NH8B: NH8B_2008Help
Entry
NH8B_2008         CDS       T01619                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
pse00071  Fatty acid degradation
pse00072  Synthesis and degradation of ketone bodies
pse00280  Valine, leucine and isoleucine degradation
pse00310  Lysine degradation
pse00362  Benzoate degradation
pse00380  Tryptophan metabolism
pse00620  Pyruvate metabolism
pse00630  Glyoxylate and dicarboxylate metabolism
pse00640  Propanoate metabolism
pse00650  Butanoate metabolism
pse00900  Terpenoid backbone biosynthesis
pse01100  Metabolic pathways
pse01110  Biosynthesis of secondary metabolites
pse01120  Microbial metabolism in diverse environments
pse01130  Biosynthesis of antibiotics
pse01200  Carbon metabolism
pse01212  Fatty acid metabolism
pse02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NH8B_2008
   00630 Glyoxylate and dicarboxylate metabolism
    NH8B_2008
   00640 Propanoate metabolism
    NH8B_2008
   00650 Butanoate metabolism
    NH8B_2008
  Lipid metabolism
   00071 Fatty acid degradation
    NH8B_2008
   00072 Synthesis and degradation of ketone bodies
    NH8B_2008
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NH8B_2008
   00310 Lysine degradation
    NH8B_2008
   00380 Tryptophan metabolism
    NH8B_2008
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NH8B_2008
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NH8B_2008
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NH8B_2008
Enzymes [BR:pse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NH8B_2008
Exosome [BR:pse04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NH8B_2008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: BAK76823
UniProt: G2J428
Position
2101020..2102204
Genome map
AA seq 394 aa AA seqDB search
MSQKQIYVVGAARTAIGTFGGALKDVAPTQLGTLVVKAALERAKVDPAAVGQVVMGNVIP
TDCKDAYLSRVVAMDAGIPKETPAFNVNRLCGSGLQAIVLAAQSILLGDADVAVGGGAES
MSRGPYLAPGARWGARMGDVQMIDYMLGILHDPWQKIHMGVTAENVAARYGISRAMQDEL
ALQSQQRAARAIAEGRFKEQIVPVEIAGRKGTVVFDSDEHVRADATMEQLAKMKPVFQKD
GSVTPGNASGLNDGAGAVVLASGEKVEALGLKPLARLVSWGHSGVEPEYMGIGPVEASRQ
ALERAGLGVADIDVIESNEAFAAQACAVAKELGFDPEKVNPNGSGISLGHPVGATGAIIT
TKAIYELQRSGGRYALVTMCIGGGQGIAAVFERV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagccagaaacagatctatgtagtaggcgctgcccgtaccgcgatcggcacgttcggc
ggtgcgctgaaagacgtcgcccccacccagctgggtaccctggtggtcaaggccgcgctg
gaacgcgccaaggtcgatccggccgctgtcggccaggtggtgatgggcaacgtgatcccc
accgattgcaaggacgcctacctgtcgcgcgtggtcgccatggatgccggcatccccaag
gaaaccccggccttcaacgtaaaccgcctgtgcggctccggcctgcaggccatcgtgctg
gcggcgcagtccatcctgctgggggatgccgacgtcgcggtgggcggcggcgccgagtcg
atgagccgcggcccctacctcgcccccggcgcacgctggggggcgcgcatgggcgatgtg
cagatgatcgactacatgctcggcatcctgcacgacccgtggcagaagattcacatgggc
gtgaccgccgagaacgtggcggcgcgctacggcatcagccgcgccatgcaggacgagctg
gcgctgcaaagccagcagcgtgccgcccgcgccatcgccgaaggccgtttcaaggagcag
atcgttccggtggagatcgccggccgcaagggcaccgtggtgttcgatagcgacgagcac
gtgcgtgccgacgccaccatggagcagctggccaagatgaagccggtgttccagaaagac
ggctcggtgacgccgggcaacgcctcgggcctcaacgacggcgccggcgccgtggtgctg
gccagtggcgagaaggtcgaagcgctgggcttgaagccactggcgcgcctggtgtcctgg
ggccattccggggtcgagccggagtacatgggcatcggtccggtggaagcgtcgcgtcag
gcgctcgagcgagccggcctcggcgtggcggacatcgatgtcatcgaatcgaacgaagcc
ttcgccgcccaggcctgcgccgtcgccaaggaattgggattcgacccggaaaaggtcaac
ccgaacggttccggcatctcgctgggccacccggtgggtgccaccggcgccatcatcacc
accaaggcgatctacgagctgcagcgcagcggcggccgctacgcgctggtgaccatgtgc
atcggcggcgggcagggcatcgctgcggtattcgaacgcgtgtaa

DBGET integrated database retrieval system