KEGG   Pseudogulbenkiania sp. NH8B: NH8B_2138Help
Entry
NH8B_2138         CDS       T01619                                 

Definition
(GenBank) polar amino acid ABC transporter, permease protein
  KO
K10016  histidine transport system permease protein
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
pse02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pse00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    NH8B_2138
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pse02000]
    NH8B_2138
Transporters [BR:pse02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    NH8B_2138
   Histidine transporter
    NH8B_2138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: BAK76953
UniProt: G2J4F8
Position
2228805..2229494
Genome map
AA seq 229 aa AA seqDB search
MFLQGFGPLIFEGTLQTIKLALVSMLLSVLIGLVGASAKLSSHRPLRYLATAYTTLIRSV
PDLVIMLLLFYSLQILLNQLTDWAGIEQIDIDPFLAGVVTLGFIYGAYFTETFRGAFQAV
PRGQLEAATAYGMKPWLVFRRVLFPQMMRFALPGIGNNWQVMIKATALVSIIGLADIVKA
TQDAGKSSMQLFFFSIVGGLIYLAITTLSNGVLLWLERRYSVGVRKAEL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtttctgcaaggctttggcccgctgatttttgagggaacgctgcagaccatcaagctg
gcactggtgtcgatgctgctctccgtcctgatcggactggtgggcgcctcggccaagctg
tccagccaccgaccgttgcgatacctcgccaccgcctacaccacactgatccgcagcgtg
cccgacctggtgatcatgctgctgctgttctacagcctgcaaatcctgctcaaccagctc
accgactgggccggcatcgagcagatcgacatcgaccccttcctcgccggggtggtgacg
ctgggcttcatctacggcgcctatttcaccgaaaccttccgcggcgccttccaggccgtg
ccgcgcggccagctcgaggccgccaccgcctacggcatgaagccgtggctggtattccgc
cgtgtgctgtttccgcagatgatgcgcttcgcactgccgggcatcggcaacaactggcag
gtgatgatcaaggccaccgccctggtgtccatcatcggcctggccgacatcgtcaaggcg
acccaggacgccggcaagagttcgatgcagctgtttttcttcagcatcgtgggcgggctg
atctacctcgccatcaccacgctgtcgaacggggtgttgttgtggttggagcgccgttat
tcggtcggcgtcagaaaggctgagctatga

DBGET integrated database retrieval system