KEGG   Pseudogulbenkiania sp. NH8B: NH8B_2386Help
Entry
NH8B_2386         CDS       T01619                                 

Definition
(GenBank) bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II-like protein
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
pse00740  Riboflavin metabolism
pse00790  Folate biosynthesis
pse01100  Metabolic pathways
pse01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pse00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    NH8B_2386
   00790 Folate biosynthesis
    NH8B_2386
Enzymes [BR:pse01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     NH8B_2386
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     NH8B_2386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: BAK77200
UniProt: G2J555
Position
complement(2503484..2504590)
Genome map
AA seq 368 aa AA seqDB search
MTISPIQDIIADIKAGKMVVLVDAEDRENEGDLVMAAEHVTPEAINFMAKHGRGLICLTL
TEERCKQLNLPMMATNNGTSFGTNFTVSIEAAEGVTTGISAADRAHTTLVAVAREAKPTD
IVQPGHVFPLKAQKGGVLVRAGHTEAGCDLSRLAGLEPASVICEIMNDDGTMARLPELME
FAATHGLKIGTIASLINYRSETENLVEHVGQRPIDTPFGSFDMHVFRDTMTQATHLALAK
GDIRADQETLVRVHEPLSVMDLIDPLGSPHSWTVPNALEIIEETGKGVMILLHRNETGLD
LLARALPQQEAPKAKWDGKTFGIGAQMLKSLGVGKMKLMSTPLNLPSMTGFELEVTGFCQ
PEHVHIEI
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaccatctccccgattcaggacatcatcgccgacatcaaggccggcaagatggtggtg
ctggtggacgccgaggaccgcgagaacgaaggcgatctggtaatggcagccgagcacgtc
acgccggaagcgatcaatttcatggccaagcacggccgcggcctgatctgcctgacgttg
accgaagagcgctgcaagcaactgaacctgccgatgatggcgaccaacaacggcaccagt
ttcggcaccaatttcacggtgtcgatcgaagccgccgagggcgttaccaccggcatctcc
gccgccgatcgcgcccacaccaccctggtggcggtggcgcgcgaggccaagccgaccgac
atcgtgcagccgggtcacgttttcccgttgaaggcgcaaaagggcggcgtgctggtgcgt
gccggccataccgaggcagggtgcgacctgtcgcgtctggccggactggagccggcctcg
gtgatctgcgaaatcatgaacgacgacggcaccatggcgcgcctgcccgagctgatggaa
tttgctgccacccacggcttgaagatcggcaccatcgccagcctgatcaactaccgcagc
gagaccgagaacctggtcgagcacgtcggccagcgcccgatcgacaccccgttcggctcg
ttcgatatgcacgtattccgcgacaccatgactcaggccacccacctggcgctggccaag
ggggatatccgtgccgatcaggaaaccctggtgcgcgtgcacgagccgctgtcggtgatg
gacctgatcgatccgctcggcagcccccactcctggaccgtgcccaatgccctggaaatc
atcgaggaaaccggcaagggcgtgatgatcctgctgcatcgcaacgaaaccgggctggat
ctgctggcccgtgccttgccgcagcaagaagcgcccaaggcaaaatgggatggcaaaacc
ttcggcatcggcgcccaaatgctgaaatcgctgggggtaggcaagatgaagctgatgtcg
actccgctcaacctgccgtcgatgaccggcttcgagcttgaggtcaccggattctgccag
cccgaacacgtccacatcgaaatctag

DBGET integrated database retrieval system