KEGG   Pseudogulbenkiania sp. NH8B: NH8B_3578Help
Entry
NH8B_3578         CDS       T01619                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
pse00900  Terpenoid backbone biosynthesis
pse01100  Metabolic pathways
pse01110  Biosynthesis of secondary metabolites
pse01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NH8B_3578
Enzymes [BR:pse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     NH8B_3578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C PET10
Motif
Other DBs
NCBI-ProteinID: BAK78328
UniProt: G2J029
Position
complement(3754551..3755393)
Genome map
AA seq 280 aa AA seqDB search
MTAVFHAYPAPAKLNLMLKVVGRRADGYHLLETVFRFIDYSDTVELAVRDDGVIELLNPI
DGVPAERDLTVRAARLLQQHSGTPLGASIRLTKRIPMGGGLGGGSSDAATVLLALNALWQ
TAVPRETLMQLGLKLGADVPVFIFGRNAFATGIGEELTELELPEKWYVVLHPGVHVPTAE
IFSSELLTRDSDISIMRILETTQQRRNDLQRVVTSKYPAVNEALSELEKYGSPLMTGSGS
CVFLECDSEIEADKVYKTLSQKYNGFVAKGLSVHPLFDSI
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgtcttccatgcctatccggctccggccaaactcaatctgatgctcaaggtg
gtggggcgccgcgccgacggctaccacctgctggaaaccgtgttccgcttcatcgactac
agcgacaccgtcgagctggccgtgcgcgacgacggcgtgatcgagctgctgaacccgatc
gacggcgtgccggccgagcgcgacctgacggtgcgtgcggcacgcctgctgcaacagcac
agcggcaccccgctcggcgcctcgatccgcctcaccaagcgcattccgatgggcggtggt
ctgggcggcggcagttccgacgccgccaccgtgctgctggcgctcaacgcgctgtggcag
accgctgtgccgcgcgaaaccctgatgcagctgggcctgaagctgggggccgatgtgccg
gtcttcatcttcggccgcaacgcctttgccaccggtatcggcgaggaactgaccgagctg
gagctgccggaaaagtggtacgtggtgttgcatccgggggtgcatgtgccgactgctgaa
attttttcgtcagaactgttgacaagggattccgacatcagcataatgcgaatcctcgaa
acaacgcagcaacgacgaaacgacttgcagcgggttgtaacgagtaagtatccagcggta
aacgaagcgttaagcgagcttgagaaatacggttcgccgctgatgacaggctccggaagt
tgtgtttttctggagtgcgattcggaaatcgaagccgataaagtttataagacgctgtcg
cagaagtacaacggatttgtcgcaaaaggcctttcggtccacccgttgttcgacagtatc
tag

DBGET integrated database retrieval system