KEGG   Pseudogulbenkiania sp. NH8B: NH8B_3879Help
Entry
NH8B_3879         CDS       T01619                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
pse00010  Glycolysis / Gluconeogenesis
pse00020  Citrate cycle (TCA cycle)
pse00620  Pyruvate metabolism
pse01100  Metabolic pathways
pse01110  Biosynthesis of secondary metabolites
pse01120  Microbial metabolism in diverse environments
pse01130  Biosynthesis of antibiotics
pse01200  Carbon metabolism
Module
pse_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NH8B_3879
   00020 Citrate cycle (TCA cycle)
    NH8B_3879
   00620 Pyruvate metabolism
    NH8B_3879
Enzymes [BR:pse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NH8B_3879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H PYNP_C Peptidase_M23 DUF2118 HlyD_D23 PTS_EIIA_1 CAT
Motif
Other DBs
NCBI-ProteinID: BAK78626
UniProt: G2J1D5
Position
complement(4072391..4074010)
Genome map
AA seq 539 aa AA seqDB search
MSNLIELKVPDIGGHDNVDVIELFIQPGATVALDDSLITLETDKATMEVPAAAAGVVKQV
LVKVGDKVSEGSVIALVEAAGAAAVAAPAAAPAPAAAPAPLAAAAPAAAPVATGRVEITV
PDIGGHAGVDVIEVTVKPGDVIAIDDSLITLETDKATMEVPATAAGKVLEVKVKVGDKVS
QGDLIVVVEGAASANVAAAPAAAAAPVAAAPAPAPAPVAAAVAPAASAKIDEAAFSKAHA
GPSARRFARELGVDLGKVQGSGRKGRIVEADIKAYVKGVLSAPPAAAPAAGGSGVGLDLL
PWPKVDFAKFGPIETKPLSRIQKISGANLSRNWVMIPHVTFNDECDITELEDFRKTIGKE
WEKSGLKISPLAFIIKAAAEALKAFPTFNSSLDGDNLVLKQYYHIGFAADTPNGLVVPVI
KNVDQKGIKQIAKELTDLSLLAREGKLKPTDMQGATFTISSLGGIGGTSFTPIVNAPEVA
ILGVCKSQIKPVWNGKDFAPRLMCPLSLSFDHRVIDGAAAARFTVHLGKLLSDVRRLIL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatctcatcgaattgaaagtacccgacatcggcggtcacgataacgtcgacgtc
atcgaactgttcatccagcccggcgccaccgtggcgctggacgactcgctgatcacgctg
gaaaccgacaaggccaccatggaagtcccggccgccgccgccggcgtcgtcaagcaggtg
ctggtcaaggtgggcgacaaggtcagcgaaggcagcgtgatcgcgctggtggaagccgcc
ggcgccgctgccgtcgcagccccggccgccgctccggcgccagccgcggctcccgctccg
ttagccgccgccgcacccgccgcggctccggtcgccaccggccgcgtcgagatcaccgtg
ccggacatcggcggccacgccggcgtcgacgtcatcgaggtgacggtgaagccgggcgac
gtgatcgccatcgacgattcgctgatcacgctggaaaccgacaaggccaccatggaagtg
ccggccaccgccgccggcaaggtgctggaggtgaaggtcaaggtgggtgacaaggtcagc
cagggcgacctgatcgtggtggtggaaggcgcggcttcggccaacgtggcggcggctccg
gctgctgctgccgccccggttgccgccgcacccgccccggctccggctccggttgccgcc
gccgtggcaccggccgccagcgccaagatcgacgaggccgccttcagcaaggcgcacgcc
ggtccgtcggcacgccgcttcgcgcgcgaactgggcgtcgacctgggcaaggtccagggc
tccggccgcaagggccgcatcgtcgaggccgacatcaaggcctacgtcaagggcgtgctg
agcgccccgccggccgccgccccggccgctggcggcagcggcgtgggtctcgacctgctg
ccgtggccgaaggtcgatttcgccaagttcggcccgatcgaaaccaagccgctgagccgc
atccagaagatctccggcgccaacctcagccgcaactgggtgatgatcccgcacgtgacg
ttcaacgacgagtgcgacatcaccgagctggaagacttccgcaagaccatcggcaaggaa
tgggaaaagtccggcctgaagatcagcccgctggccttcatcatcaaggccgccgccgag
gcgctgaaggcgttcccgaccttcaacagctcgctcgacggcgacaacctggtgctcaag
cagtactaccacatcggcttcgccgccgacacgccgaacggcctggtggtcccggtgatc
aagaacgtcgatcagaagggcatcaagcagatcgccaaggaactgaccgatctgtcgctg
ctggcacgcgaaggcaagctcaagccgaccgacatgcagggcgccaccttcaccatctcc
agcctgggcggcatcggcggtaccagcttcacgccgatcgtcaacgcgccggaagtggcc
atcctcggcgtctgcaagagccagatcaagccggtgtggaacggcaaggacttcgcgccg
cgcctgatgtgcccgctgagcctgtcgttcgaccaccgcgtgatcgacggcgccgccgcg
gcgcgcttcaccgtgcacctgggcaagctgctgtccgacgtgcgccgtctgatcctctga

DBGET integrated database retrieval system