KEGG   Pseudonocardia sp. AL041005-10: WY02_01865Help
Entry
WY02_01865        CDS       T04051                                 

Definition
(GenBank) aldehyde dismutase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
psea  Pseudonocardia sp. AL041005-10
Pathway
psea00625  Chloroalkane and chloroalkene degradation
psea00680  Methane metabolism
psea01100  Metabolic pathways
psea01120  Microbial metabolism in diverse environments
psea01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psea00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    WY02_01865
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    WY02_01865
Enzymes [BR:psea01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     WY02_01865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C PALP ADH_N_assoc Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ALE77420
UniProt: A0A0M5LQJ3
Position
complement(531021..532235)
Genome map
AA seq 404 aa AA seqDB search
MPDNRVVVYKGPGEVAVESIDYPKLELPTDVVDGLGIQRKAPHAAILKIVTTNICGSDQH
MVRGRTTAPVGQSLGHEITGEIVEVGDDVLFAKVGDICSVPFNIACGRCRMCNEGKTGVC
LNVNPARPGAAYGYVDMGGWIGGQAEYVMVPFADFNLLRFPDRDQALEKILDLTMLSDIF
PTGYHGAVTAGVTTGSTVYVAGAGPVGLAAAHAAQLLGAAAVVVGDMIPERLAQARSFGC
ETVDLSGDGTLAEQLEQLLGEPEVDAAVDAVGFEARGHGRDAGEAPATVLNSVMEVTRVG
GALGIPGLYVTGDPGAADDKAKEGTLGVRIGLGWAKSHSFTTGQCPVKKYNRQLMQAILS
DRAQIAKAVNATTITLDDAPRGYQEFDGGVARKFVIDPHGSVAA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacaaccgcgtcgtcgtgtacaagggacccggcgaggtcgccgtcgagtcgatc
gactacccgaagctggagctgcccaccgacgtcgtcgacgggctcggcatccagcggaag
gctccgcacgcggcgatcctgaagatcgtcaccaccaacatctgcggatccgaccagcac
atggtccgcggccgcaccaccgcaccggtcgggcagtcgctcggccacgagatcaccggc
gagatcgtcgaggtcggcgacgacgtgctgttcgcgaaggtcggcgacatctgctcggtg
ccgttcaacatcgcctgcgggcgctgccggatgtgcaacgagggcaagaccggcgtctgc
ctgaacgtcaacccggcccgtcccggcgccgcctacggctacgtcgacatgggcggctgg
atcggcggccaggccgagtacgtgatggtgcccttcgccgacttcaacctgctgcgcttc
cccgaccgcgaccaggcgttggagaagatcctcgacctcacgatgctgtcggacatcttc
ccgaccggctaccacggcgcggtgaccgccggggtcaccaccggatcgacggtctacgtg
gccggcgccgggccggtcgggctggccgcggcgcacgccgcgcagctgctgggggcggcg
gcggtcgtcgtcggggacatgatccccgagcggctcgcgcaggcgcgcagcttcggctgc
gagacggtcgacctgtccggcgacgggaccctggccgagcagctcgagcagctgctcggc
gagcccgaggtcgacgccgccgtcgacgccgtcgggttcgaggcccgcgggcacggccgc
gacgccggggaggcgcccgcgaccgtgctgaactcggtcatggaggtgacccgggtcggc
ggcgcgctcggcatccccgggctctacgtcaccggcgacccgggtgccgccgacgacaag
gccaaggagggcaccctcggcgtgcgcatcggtctgggctgggccaagtcgcacagcttc
accaccggccagtgcccggtgaagaagtacaaccggcagctgatgcaggcgatcctgtcc
gaccgggcgcagatcgccaaggcggtcaacgcgaccacgatcacgctggacgacgccccg
cgcggctaccaggagttcgacggcggcgtggcccgcaagttcgtgatcgacccgcacggc
agcgtcgcggcgtga

DBGET integrated database retrieval system