KEGG   Pseudonocardia sp. AL041005-10: WY02_03910Help
Entry
WY02_03910        CDS       T04051                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
psea  Pseudonocardia sp. AL041005-10
Pathway
psea00770  Pantothenate and CoA biosynthesis
psea01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psea00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    WY02_03910
Enzymes [BR:psea01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     WY02_03910
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     WY02_03910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein
Motif
Other DBs
NCBI-ProteinID: ALE77731
UniProt: A0A0M4QIB5
Position
complement(933626..934843)
Genome map
AA seq 405 aa AA seqDB search
MAPPEVLLGVSGGIAAYKSAEVLRRLTESGHAVRVIPTESALRFVGAATFEALSGRPVAT
GVFHDVHEVPHVALGKGADLVVVAPATADLMARLAHGRSDDLLTAALLTARCPVVLAPAM
HTEMWEHPATVDNVALLRARGTVVIEPAAGRLTGADTGKGRLPDPAEIVDLARLLLERPD
ALPRDLEGRHVVVSAGGTREDLDPVRFLGNRSSGRQGWALARVAAQRGARVTLVAGHTAD
LGAPAGVDVVAAGTAVAMEAAVRGAAADADAVVMAAAVADFRPVDTAADKIKRGDAEPAP
LRLTQNPDILAGLVADPPRPGQVVVGFAAETGDADGDVLHHGRAKLARKGCDLLVVNAVG
DGKAFETTDNAGWLLARDGGEDELPFGSKALLASRIWDAVVPRLR
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggctcctcccgaggtgctcctcggcgtctccggcggcatcgccgcctacaagagcgcc
gaggtgctgcgtcgcctgaccgagtccggccacgcggtgcgggtgatccccaccgagtcc
gcgctgcggttcgtcggggccgcgacgttcgaggccctgtccggccggcccgtcgccacc
ggggtgttccacgacgtccacgaggtgccgcacgtggccctgggcaagggtgcggacctc
gtcgtcgtcgccccggcgaccgcggacctcatggcccgcctcgcgcacggccgctccgac
gacctgctgaccgccgcgctgctgaccgcccggtgcccggtggtgctggcgcccgcgatg
cacaccgagatgtgggagcaccccgcgacggtcgacaacgtcgccctgctgcgcgcccgc
ggcaccgtggtgatcgagcccgccgcgggccggctgaccggcgcggacaccggtaagggc
cggctgcccgacccggccgagatcgtcgacctggcccggctgctgctggagcgcccggac
gcgctgccgcgcgacctggagggccgccacgtggtcgtcagtgccggcgggacccgggag
gacctcgacccggtccggttcctcggcaaccggtcctcgggccggcagggctgggcgctg
gcccgggtcgccgcccagcgcggcgcacgggtgacgctcgtcgccgggcataccgcggac
ctcggcgccccggccggggtggacgtggtcgccgcggggaccgccgtcgccatggaggcc
gccgtccgcggtgccgccgccgacgcggacgccgtggtgatggccgccgcggtcgcggac
ttccggccggtcgacaccgccgccgacaagatcaagcgcggcgacgcggagccggcgccg
ctgcgcctgacccagaatcccgacatcctcgccgggctcgtggccgacccgccgcggccg
ggtcaggtcgtggtcgggttcgccgccgagaccggcgacgccgacggcgacgtgctccac
cacggccgcgccaagctggcccgcaagggctgtgacctgctggtggtgaacgcggtcggc
gacggcaaggccttcgagaccacggacaatgccggctggctgctcgcccgcgacggcggc
gaggacgagctgccgttcggctccaaggcgctgctcgcctcccgcatctgggacgcggtc
gtcccgcgcctgcgctga

DBGET integrated database retrieval system