KEGG   Pseudonocardia sp. AL041005-10: WY02_04890Help
Entry
WY02_04890        CDS       T04051                                 

Definition
(GenBank) amino acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
psea  Pseudonocardia sp. AL041005-10
Pathway
psea00350  Tyrosine metabolism
psea00360  Phenylalanine metabolism
psea00380  Tryptophan metabolism
psea01100  Metabolic pathways
psea01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psea00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    WY02_04890
   00360 Phenylalanine metabolism
    WY02_04890
   00380 Tryptophan metabolism
    WY02_04890
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psea04147]
    WY02_04890
Enzymes [BR:psea01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     WY02_04890
    4.1.1.105  L-tryptophan decarboxylase
     WY02_04890
Exosome [BR:psea04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   WY02_04890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ALE77883
UniProt: A0A0M4QVS3
Position
1138915..1140351
Genome map
AA seq 478 aa AA seqDB search
MPDLTPDEFRALGHLFVDAVADARAGIERHPVRDVVEPGTVRARFPREANEGPEPLAAFP
SLVEAVTGDADTRWQHPGFHAFFPANASLTSLLGELLSGGAGAQGMLWSTSPACTEVEQA
VTDQLARALGLDETFTHDGGGGGSIQDSASSAALVALTAALHRAAPDPDSGWRVRGVTGR
ERVYVTAETHSSLAKAVRVAGLGSDGLRTVGCTPGSRAMDPAALTDTLAADVAAGLVPVL
VCATVGTTSTGSSDPVAALVTAARPYRAWVHVDAAWAGVAALCPEHRWVLDGVNPGPGPG
VDSFCTDAHKWLLTAFDASLLWVRDARALPAALSITPAYLRDAHSDSGDVVDFRDWQVPL
GRRFRALKLWAVLHGQGLSGLRSHLRGHVDLAAELAERVRGHDDLELACAPVLSLVCLRS
RSGDAATTALLERANADGRVLLTGTEVDGHPVVRVAFGGVTTSREHLDVVWDVLSARS
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgacctcaccccggacgagttccgagccctcggccacctgttcgtcgacgccgtc
gccgacgcccgcgccgggatcgaacgccacccggtccgcgacgtcgtcgagcccggcacc
gtgcgggcccgcttcccccgcgaggcgaacgagggccccgagccgctcgcggcgttcccg
tcgctggtcgaggccgtcaccggtgacgccgacacccgctggcagcaccccgggttccac
gcgttcttcccggcgaacgcctcgctgacctcgctgctgggtgagctgctctccggcggc
gccggggcgcagggcatgctctggtcgacctcgcccgcgtgcaccgaggtggagcaggcg
gtcaccgaccagctggccagggcgctcggactggacgagacgttcacccacgacggcggc
gggggcggctcgatccaggactcggcgtcctcggcggcgctggtcgcgctgaccgccgcg
ctgcaccgggccgcgccggacccggactccggctggcgcgtgcgcggggtgacgggccgg
gaacgcgtctacgtcacggccgagacgcactcgtcgctggccaaggcggtgcgggtggcc
gggctcggctccgacgggctgcgcaccgtcggatgcaccccgggctcccgggcgatggac
ccggccgcgctgaccgacaccctggccgcggacgtcgccgcagggctggtcccggtgctg
gtgtgcgcgacggtcgggacgacctcgaccgggtcgagcgacccggtcgcggcgctggtc
acggcggcgcggccgtaccgggcctgggtgcacgtcgacgccgcgtgggcgggcgtcgcc
gcgctctgcccggagcaccgctgggtgctcgacggcgtgaacccgggcccggggcccggc
gtcgactccttctgcaccgacgcccacaagtggctgctcaccgcgttcgacgcctcgctg
ctctgggtgcgcgacgcccgcgcgctgccggccgcgctgtcgatcaccccggcctacctg
cgcgacgcgcactccgactccggcgacgtcgtggacttccgggactggcaggtcccgctc
gggcgtcggttccgggccctgaagctgtgggcggtgctccacggccaggggctgtccggg
ctgcggtcacacctgcgcgggcacgtcgacctcgccgccgagctggccgagcgggtccgc
gggcacgacgacctggagctggcgtgcgcgccggtgctgtccctggtctgcctccgctcg
cgctccggcgacgccgcgaccaccgcgctgctggaacgcgccaacgccgacggacgggtg
ctgctcaccggcaccgaggtcgacgggcaccccgtggtgcgggtggcgttcggcggggtc
accacgagccgcgagcacctcgacgtcgtgtgggatgtcctgtctgcccgatcgtga

DBGET integrated database retrieval system