KEGG   Pseudonocardia sp. AL041005-10: WY02_06940Help
Entry
WY02_06940        CDS       T04051                                 

Definition
(GenBank) cobalamin biosynthesis protein CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
psea  Pseudonocardia sp. AL041005-10
Pathway
psea00860  Porphyrin and chlorophyll metabolism
psea01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psea00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    WY02_06940
Enzymes [BR:psea01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     WY02_06940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 GATase DJ-1_PfpI SNO Peptidase_S51
Motif
Other DBs
NCBI-ProteinID: ALE78208
UniProt: A0A0M4QWG7
Position
complement(1593734..1595263)
Genome map
AA seq 509 aa AA seqDB search
MVQGAVLVAGTTSDAGKSAVVAGICRWLHRRGVSVAPFKAQNMSNNSIVTPDGGEIGRAQ
AMQAFASGIAPSVDLNPVLLKPGGDRTSQVVVRGRADGQVSALSYRHRTAALSDVVADSL
ARLRARHDVVVCEGAGSPAEINLRATDLANMGFARRNDLPVLVVGDIDRGGVLAHLFGTL
AVLDPADQALIAGFVINKFRGDPRLLDPGLDRLRELTGRPTLGVLPFAEGLWLDAEDSLS
AVADGVLGRPAPPRGGQWLRVAVVRFPRISNATDAEALACEPGVAVRYVTEPSRIADADV
VVLPGTKATVSDLAWLRASGMADAVRAHAAAGRPVLGICGGYQMLGHTVSDPDGAEAAPG
TTVAGLGLLDLEIAFDPVKHLATPTATAWGETVTGYEIHHGRVVRSGDPGLIGDEGSDRG
NVLGTHWHGLAENDGFRRRLLTRLADEAGRTGFAVAQDTSFAAERTRQVDLLADLVEHHL
DTSSLEHVIGHGAPPDLPVLTSGLAASPA
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
gtggttcagggagcggtcctcgtcgcggggacgacgtcggacgcgggcaagagcgccgtc
gtcgccggtatctgccggtggctgcaccggcgcggcgtctcggtggcgccgttcaaggca
cagaacatgagcaacaactcgatcgtcaccccggacggcggcgagatcggccgcgcgcag
gcgatgcaggccttcgccagcggcatcgccccgtcggtcgacctgaacccggtgctgctc
aagcccggtggggaccggacctcccaggtcgtcgtgcgcggccgcgccgacggccaggtg
tcggcgctgtcctaccggcaccgcaccgcggcgctgtccgacgtcgtcgccgactccctg
gcccggctgcgcgcccgccacgacgtcgtggtctgtgaaggagcgggctcgcccgcagag
atcaacctgcgggccaccgacctcgccaacatgggcttcgcccggcgcaacgacctgccg
gtgctggtcgtcggcgacatcgaccgcggcggggtgctcgcgcacctgttcggcaccctc
gccgtgctcgacccggccgaccaggcgctgatcgccggtttcgtgatcaacaagttccgc
ggggacccccgcctgctcgaccccggcctcgaccggctgcgcgagctcaccgggcggccg
acgctgggcgtgctgcccttcgccgagggcctctggctcgacgccgaggactcgctctcg
gccgtcgccgacggggtgctcggacgcccggccccgccgcgcggcgggcagtggctgcgg
gtcgccgtcgtccggttcccgcggatctccaacgccaccgacgccgaggcgctggcctgc
gaaccgggcgtcgccgtgcggtacgtgaccgagccgtcgcggatcgccgacgccgacgtc
gtcgtgctgcccgggaccaaggcgaccgtgtcggacctggcctggctgcgcgcgtccggg
atggccgacgcggtgcgcgcgcacgccgcggccgggcgcccggtgctggggatctgcggc
gggtaccagatgctcgggcacacggtctccgacccggacggcgccgaggccgctcccggc
acgaccgtcgccgggctggggctgctggacctcgagatcgcgttcgacccggtcaagcac
ctcgccacccccaccgcgacggcgtggggcgagaccgtcaccggctacgagatccaccac
ggccgcgtcgtgcgctccggcgaccccggcctgatcggggacgagggcagcgaccgcggc
aacgtcctgggcacgcactggcacggcctcgccgagaacgacggcttccggcggcggctg
ctcacccgcctcgccgacgaggcaggacggaccgggttcgcggtggcgcaggacacgtcg
ttcgcggccgagcgcacccggcaggtggatctgctggccgacctggtcgaacaccacctg
gacacgtcgtcacttgaacatgtgatcggacacggtgcgccgccggacctcccggtgctg
acctccggtctggcagcctctccggcgtga

DBGET integrated database retrieval system