KEGG   Pseudomonas sp. CCOS 191: CCOS191_1412Help
Entry
CCOS191_1412      CDS       T03967                                 

Definition
(GenBank) phosphoesterase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
psec  Pseudomonas sp. CCOS 191
Brite
KEGG Orthology (KO) [BR:psec00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CCOS191_1412
Enzymes [BR:psec01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     CCOS191_1412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: CRI55948
UniProt: A0A0F7Y2R8
Position
I:1575312..1576172
Genome map
AA seq 286 aa AA seqDB search
MNVDLHCHSTASDGALSPTALVARAHEHGVRTLSLTDHDTLEGLPEARQACLDNGMQWVS
GVELSCTWGGATIHVLGYDFPLDAPALLDAIANLHRGRWLRAEEIDRKLAAKGMPGALDG
ARAVQQELGDSGNAPARPHFAEFMVRAGFVKDRGEAFRKWLGAGKLGDVKLHWPTLEETV
ATLRESNAWVSLAHPMHYELTRSKRRRLIADYIQAGGQALEVVNGMMPPEQVGTMSILTR
EFGLLASAGSDFHGPGTWGEIGAYRPLPEDLPPLWRRFRHEQPMAV
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttgatctgcactgtcacagcacggcctccgacggcgccttgtcgcccacggca
ctggtcgcccgggcccatgagcacggggtgcgcacgctctcgctcaccgaccatgacacc
cttgaaggcctgccggaggcgcgccaggcctgcctggacaacggcatgcagtgggtcagc
ggcgtggagctgtcgtgcacctggggcggcgccaccattcatgtgctgggctacgacttc
cctctcgacgcgccggcgttgctcgatgccatcgccaacctgcaccgtggtcgttggctg
cgcgccgaggaaatcgaccgcaagctggcggccaagggcatgcccggcgcgctggacggc
gcgcgggccgtgcagcaggaactgggcgacagcggcaacgccccggcgcgtccgcatttc
gccgagttcatggtccgcgccggcttcgtcaaggaccgcggcgaggcgttccgcaagtgg
ctgggcgccggcaagctgggcgacgtcaagctgcactggccgacgcttgaggaaactgtc
gcgacgctgcgtgagtccaatgcgtgggtgagcctggcccatcccatgcactacgaactg
acccgcagcaagcgcagacggctgattgccgactatattcaggctggagggcaggcactg
gaagtggtcaacgggatgatgccgcccgagcaggtggggacgatgtcgatcctcacccgt
gagttcggcctgctggcaagcgccggcagcgacttccacggccctggcacctggggcgag
atcggtgcctaccggccattgcctgaggacctgccacccctgtggcgccgattccgacat
gaacagcctatggcggtatga

DBGET integrated database retrieval system