KEGG   Pseudomonas sp. CCOS 191: CCOS191_2274Help
Entry
CCOS191_2274      CDS       T03967                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psec  Pseudomonas sp. CCOS 191
Pathway
psec00071  Fatty acid degradation
psec00072  Synthesis and degradation of ketone bodies
psec00280  Valine, leucine and isoleucine degradation
psec00310  Lysine degradation
psec00362  Benzoate degradation
psec00380  Tryptophan metabolism
psec00620  Pyruvate metabolism
psec00630  Glyoxylate and dicarboxylate metabolism
psec00640  Propanoate metabolism
psec00650  Butanoate metabolism
psec00900  Terpenoid backbone biosynthesis
psec01100  Metabolic pathways
psec01110  Biosynthesis of secondary metabolites
psec01120  Microbial metabolism in diverse environments
psec01130  Biosynthesis of antibiotics
psec01200  Carbon metabolism
psec01212  Fatty acid metabolism
psec02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CCOS191_2274
   00630 Glyoxylate and dicarboxylate metabolism
    CCOS191_2274
   00640 Propanoate metabolism
    CCOS191_2274
   00650 Butanoate metabolism
    CCOS191_2274
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CCOS191_2274
   00072 Synthesis and degradation of ketone bodies
    CCOS191_2274
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCOS191_2274
   00310 Lysine degradation
    CCOS191_2274
   00380 Tryptophan metabolism
    CCOS191_2274
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CCOS191_2274
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCOS191_2274
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CCOS191_2274
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psec04147]
    CCOS191_2274
Enzymes [BR:psec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CCOS191_2274
Exosome [BR:psec04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CCOS191_2274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III Sulfatase
Motif
Other DBs
NCBI-ProteinID: CRI56810
UniProt: A0A0F7XWT1
Position
I:2533081..2534259
Genome map
AA seq 392 aa AA seqDB search
MFHDSVAIVAAAHSPFGRLDGLNLEDLIVQVTRDALQDAGIDAAEIDALFLGHFNSGLVA
DGFPASLMLQADPQLRFKPATRCENACASGSAAIQAGINAIRSGAAELVLVVGAEKMTGN
STVEVTRALAGAGYQNALQEAGLSFAQLFGQVAQQYTERYHSPLASMAAIAVKNHANAMA
NPLAQMHRVMDFEHCNQVSPSNPLIAAPLRLTDCSLISDGAAAIILASPARARSMRRQVA
IRSMVQVNDFLPLSRRDMLAFEGPQRAIHGALREAGVTLNDLSFAEVHDCFTIAELLIYE
AMGLAPRGEGHRALDDGIVRQGGRLPVNLSGGLKAKGHPVGATGVSMHALGFAQLTGKPI
GLGVPNAEFGLLFNMGGMAVANYASVLQAVRV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgttccacgattccgtcgccatcgtcgccgccgcgcacagccctttcggtcgtttggat
ggcctgaacctcgaagacctgatcgtccaggtcacccgcgatgccttgcaggatgcaggc
atcgacgccgccgagatcgacgcgctgtttctcggccacttcaactcgggcctggtggcc
gacggcttccccgcctcgctgatgctgcaggccgacccgcaactgcgcttcaaacccgcc
acccgctgcgaaaacgcctgtgcctcgggctcggcggcgatccaggccgggatcaacgcg
atccgcagcggcgccgccgagctggtgctggtggtcggcgcggagaagatgaccggcaac
agcacggtcgaggtcacccgggcgctggccggcgccggttaccagaacgccttgcaggag
gccggcctgagttttgcccagctgttcggccaggtcgcccagcaatacaccgagcgctac
cacagcccactggcatcgatggcggcgatcgcggtgaagaaccacgccaatgccatggcc
aacccgctggcgcagatgcaccgggtgatggacttcgagcactgcaaccaggtgtcgccg
agcaacccgctgatcgcggcgcccctgcgcctgaccgactgctcgctgatcagcgatggt
gctgcggcgatcatcctggcttcgcctgcccgcgcccgctcgatgcggcgccaggtggcg
atccgctcgatggttcaggtcaatgacttcctgccgttgtcgcgccgcgacatgctggcc
ttcgaggggccgcagcgggccatccacggggcgctgcgcgaggcgggagtgaccctcaac
gacctgagtttcgccgaggtgcacgactgcttcaccatcgccgaactgctgatctacgaa
gccatgggcctggcgccgcgtggcgaggggcaccgcgccctggacgacggcatcgtgcgc
cagggtgggcgcttgccggtgaacttgtccggcgggctcaaggccaaggggcatccggtg
ggggccaccggggtgtcgatgcatgctctgggcttcgcccagctgaccggcaagcccatc
ggcctgggcgtgcccaatgccgagttcggcctgctgttcaacatgggcgggatggcggtg
gccaactacgccagcgtgctgcaagccgtcagggtctga

DBGET integrated database retrieval system