KEGG   Pseudomonas sp. CCOS 191: CCOS191_3137Help
Entry
CCOS191_3137      CDS       T03967                                 

Gene name
ELI5
Definition
(GenBank) Tyrosine decarboxylase 1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
psec  Pseudomonas sp. CCOS 191
Pathway
psec00350  Tyrosine metabolism
psec00360  Phenylalanine metabolism
psec00380  Tryptophan metabolism
psec01100  Metabolic pathways
psec01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psec00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CCOS191_3137 (ELI5)
   00360 Phenylalanine metabolism
    CCOS191_3137 (ELI5)
   00380 Tryptophan metabolism
    CCOS191_3137 (ELI5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psec04147]
    CCOS191_3137 (ELI5)
Enzymes [BR:psec01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     CCOS191_3137 (ELI5)
    4.1.1.105  L-tryptophan decarboxylase
     CCOS191_3137 (ELI5)
Exosome [BR:psec04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CCOS191_3137 (ELI5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 DUF1148
Motif
Other DBs
NCBI-ProteinID: CRI57673
UniProt: A0A0F7Y7N3
Position
I:complement(3579691..3581103)
Genome map
AA seq 470 aa AA seqDB search
MTPEQFRQYGHQLIDLIADYRQTVGERPVMAQVEPGYLKAALPQGAPQQGEPFEAILADV
DKLVMPGLSHWQHPDFYGYFPSNGTLSSVLGDFLSTGLGVLGLSWQSSPALSELEETTLD
WLRQLLGLSGQWSGVIQDTASTSTLVALICARERATDHAQVRGGLQAQGKPLVVYVSAHA
HSSVDKAALLAGFGRENIRLIPTDAHYAMRPEALREAIAQDLAAGNQPCAVVATTGTTTT
TALDPLRPIGEIAQANQLWLHVDSAMAGSAMILPECRWMWDGIELADSVVVNAHKWLGVA
FDCSIYYVRDPQHLIRVMSTNPSYLQSAVDGEVKNLRDWGIPLGRRFRALKLWFMLRSEG
VEALQQRLRRDLENAQWLAAQVEAASTWEVLAPVQLQTLCIRHRPDGLDGEALDAHTRAW
AERLNASGDAYVTPATLDGRWMVRVSVGALPTEREHVERLWARLQAVVAE
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgacccccgaacaattccgccaatacggccaccaactgatcgacctgatcgccgattac
cgccagaccgtcggcgaacgcccggtcatggcccaggtcgagcccggctacctcaaggcc
gcgctgccccaaggcgcgccccagcaaggcgagccgttcgaggccatcctcgccgacgtc
gacaagctggtgatgcccggcctgtcccactggcagcacccggacttctacggttacttc
ccctccaacggcaccctgtcatcagtgctcggcgacttcctcagcacgggcctgggcgtg
ctcggcctgtcgtggcagtccagcccggccctcagcgaactggaggaaaccaccctcgat
tggctgcgccagctgctcggcctgagcgggcaatggagcggggtgatccaggacaccgcc
tcgaccagcaccctggtggcgctgatctgcgcccgcgagcgtgccaccgaccatgcccag
gtgcgcggcggcctgcaggcccagggcaagcccctggtggtctacgtcagcgcccatgcc
cacagttcggtggacaaggccgcgctgctggccggattcggccgtgaaaacattcgcctg
atccccaccgacgcacactacgccatgcgcccggaggcgctgcgcgaagccatcgcccag
gacctcgccgccggcaaccagccctgcgccgtggtcgccaccaccggcaccaccaccacc
accgcgctggacccgttgcgcccgatcggcgagatcgcccaggccaaccagctgtggctg
cacgtggactcggccatggccggttcggcgatgatcctcccggaatgtcgctggatgtgg
gacggcatcgagctggccgactcggtggtggtcaatgcccacaagtggctgggcgtggcc
ttcgactgctcgatctactatgtgcgcgacccgcagcatctgatccgggtgatgagcacc
aaccccagctacctgcagtcggcggtcgatggcgaggtaaagaacctgcgcgactggggc
atccccctggggcgccggttccgcgccttgaaactgtggttcatgctgcgcagcgaaggt
gtcgaggccctgcagcaacgcctgcgccgcgacctggaaaacgcgcagtggctggccgcg
caggtggaggcggcttccacgtgggaggtattggcgccggtgcagttgcagaccttgtgc
atccgccatcgcccggacgggctggacggcgaggcgctggatgcccacacccgcgcctgg
gccgagcgcctcaacgcctcgggtgatgcctacgtgaccccggcgaccctggacgggcgc
tggatggtgcgggtctcggtgggggcgctgcccaccgagcgcgagcatgtcgagcggctg
tgggcgcggttgcaggcggtggtggcggagtaa

DBGET integrated database retrieval system