KEGG   Pseudomonas sp. CCOS 191: CCOS191_4443Help
Entry
CCOS191_4443      CDS       T03967                                 

Gene name
selD
Definition
(GenBank) Selenide, water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
psec  Pseudomonas sp. CCOS 191
Pathway
psec00450  Selenocompound metabolism
psec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psec00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CCOS191_4443 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:psec03016]
    CCOS191_4443 (selD)
Enzymes [BR:psec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     CCOS191_4443 (selD)
Transfer RNA biogenesis [BR:psec03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    CCOS191_4443 (selD)
 Prokaryotic Type
    CCOS191_4443 (selD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: CRI58979
UniProt: A0A0F7Y7C5
Position
I:5007902..5008936
Genome map
AA seq 344 aa AA seqDB search
MSEPIRLTQYSHGAGCGCKISPKVLDVILAESGTQALDPNLWVGNASRDDAAVYALDDER
GVVSTTDFFMPIVDDPYDFGRIAATNAISDIYAMGGDPLMAIAILGWPINVLPPEVAREV
IRGGRAVCAEAGIPLAGGHSIDAPEPIFGLAVTGVVSKRHLKRNDTASVGSRLYLTKPLG
IGILTTAEKKAKLREQDQGLARDWMCTLNTPGSRFGKLDGVQAMTDVTGFGLLGHLVEVA
EGSGLTARLQFAAVPRLPSVDYYLAEGCIPGGTLRNFDSYGHKIGALSDEQKHLLCDPQT
SGGLLVAVSPQGEAEFLAVARELGLELAPIGELVERQSHAVEVI
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagccgattcgtctgacacagtacagccacggcgctggttgtggctgcaagatt
tctcccaaggtgctggatgtaatcctcgccgagagcggcacccaggccctcgacccgaac
ctctgggtcggcaacgcctcgcgcgacgacgctgccgtctacgccctggacgacgaacgt
ggcgtggtctcgaccaccgacttcttcatgcccatcgtcgacgacccgtacgacttcggc
cgcatcgccgccaccaacgccatcagcgacatctacgccatgggcggcgacccgctgatg
gccatcgccatcctcggctggccgatcaacgtattgccgccggaggtcgcccgcgaagtg
atccgcggtggccgcgcggtctgcgcagaggccggcatcccattggccggtggccactcc
atcgacgccccggaaccaatcttcggcctggccgtcaccggcgtggtaagcaagcgccac
ctcaagcgcaacgacaccgccagcgtcggcagccgcctgtacctgaccaagccgctgggc
atcggcatcctcaccaccgccgagaagaaggccaagctgcgcgaacaggaccagggcctg
gcccgcgactggatgtgcaccctgaacacccccggcagccgcttcggcaagctcgacggc
gtgcaggccatgaccgacgtcaccggcttcggcctgctcggccacctggtcgaagtcgcc
gaaggcagcggcctcaccgcacgcctgcagttcgccgccgtgccgcgcctgcccagcgtc
gattactacctggccgagggttgcatccccggcggcaccttgcgcaacttcgacagctac
ggccacaagatcggcgcgctgagcgacgaacagaagcacctgctgtgcgatccgcagacc
agcggtggcctgctggtggcagtcagcccacagggcgaggcagaattcctcgccgtggca
cgggagctcgggctcgaactggcgccaatcggcgagctggtcgagcgacagagccacgca
gtcgaggtgatctga

DBGET integrated database retrieval system