KEGG   Pseudomonas sp. R2A2: DM292_02765Help
Entry
DM292_02765       CDS       T05921                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
psed  Pseudomonas sp. R2A2
Pathway
psed00471  D-Glutamine and D-glutamate metabolism
psed01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psed00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    DM292_02765
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psed01011]
    DM292_02765
Enzymes [BR:psed01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     DM292_02765
Peptidoglycan biosynthesis and degradation proteins [BR:psed01011]
 Precursor biosynthesis
  Racemase
   DM292_02765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AWT09212
UniProt: A0A2U9NA69
Position
601913..602707
Genome map
AA seq 264 aa AA seqDB search
MPDCTAPVGVFDSGVGGLSVLREIRQRLPHESLLYLADSAHVPYGEKSPEYIRERCRTIA
AFFVEQGAKALVVACNTATAAGVTELRELYPDWPIIAMEPAVKPAAAATRSGVVGVLATT
GTLKSARFAALLDRFAADVRVITQPCPGLVERIEAGDLNSVELRVMLQGWVEPLLAQGCD
TLILGCTHYPFIRPLLSRLVPRDIRLIDTGAAVARHLGKVLTERGRLADGESSCRFYCSG
DPQRMAEVLPILWGEHAEVELFSR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgcctgactgtacggcgcccgtgggcgtattcgattccggcgttggcgggctctcggtt
ctgcgcgagattcgccagcgcctgccgcacgaatcgctgctctatctggccgacagcgcc
cacgtgccttacggcgagaaaagccccgagtacatccgcgagcgctgccgcaccatcgcg
gcgtttttcgtcgagcagggcgccaaggccctggtggtggcctgcaacaccgcgacagcg
gccggcgtgaccgagctgcgcgagctgtatccggattggcccatcattgccatggagccg
gcggtaaagcccgccgccgcggccacccgcagtggcgtggtaggtgtactcgccaccacc
ggtacgctgaaaagcgccaggttcgccgcattgctcgatcgtttcgctgcggacgtgcgg
gtgatcactcagccttgcccggggctggtcgagcgcatcgaggccggcgatctgaatagc
gtcgagctgcgcgtgatgctccagggctgggtcgagccactgctggcgcagggctgcgac
acgctgatcctgggctgcactcattaccccttcattcgtccgctgctgagccgtctcgtg
cctcgcgacatccggttgattgatactggagcagcggttgcgcgccacctgggtaaggtg
ttgacggagcgcggccggctcgccgacggggaaagcagttgccgattctattgcagcggc
gatccgcagcgaatggccgaggtgctgcctatactttggggggaacatgcagaggtcgag
ttgttctcccgatag

DBGET integrated database retrieval system