KEGG   Pseudomonas sp. R2A2: DM292_06070Help
Entry
DM292_06070       CDS       T05921                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
psed  Pseudomonas sp. R2A2
Pathway
psed00480  Glutathione metabolism
psed00590  Arachidonic acid metabolism
psed01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psed00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    DM292_06070
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DM292_06070
Enzymes [BR:psed01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     DM292_06070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AWT09817
UniProt: A0A2U9N9E2
Position
1280156..1280638
Genome map
AA seq 160 aa AA seqDB search
MRDPLFDIPCVTIDGEHKTLADFDAKVLLVVNTASQCGFTPQYKGLEELWQRYGERGLVV
LGFPCNQFGGQEPDSEAQIATFCERRFGVSFPLFAKVEVNGGDAHPLFIELKKRAPGLLG
SKAIKWNFTKFLIADQGRTVRRYSSRTAPQALAADIEALL
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgatcctctgttcgatattccctgtgtcaccatcgacggcgagcacaagacgctc
gccgatttcgatgccaaggtgctgctcgtggtgaacactgccagccaatgcggtttcacg
ccccagtacaagggattggaggaactctggcagcgctacggcgagcgcggcctggtcgtg
ctcggttttccgtgcaaccagttcggcggacaggagccggatagcgaggcgcagatcgcc
accttctgcgagcgccggttcggcgtgtccttccccttgttcgccaaggtcgaggtcaat
ggcggcgacgcccatccgctgttcatcgagctgaagaagcgcgcgcccggcctgctgggc
agcaaggcgatcaagtggaatttcaccaagtttctcatcgccgatcagggtcgcacggtc
aggcgctattcctcacgtacggcgccgcaggcgctggcggcggatatcgaggcgctgctc
tga

DBGET integrated database retrieval system