KEGG   Pseudomonas sp. R2A2: DM292_14170Help
Entry
DM292_14170       CDS       T05921                                 

Definition
(GenBank) carbon-nitrogen hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
psed  Pseudomonas sp. R2A2
Brite
KEGG Orthology (KO) [BR:psed00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DM292_14170
Enzymes [BR:psed01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     DM292_14170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase DUF442
Motif
Other DBs
NCBI-ProteinID: AWT11259
UniProt: A0A2U9NEM0
Position
complement(3031216..3032061)
Genome map
AA seq 281 aa AA seqDB search
MSLSVIQMTSQADVAGNLAAARRLLEQAAAAGARLAVLPENFAAMGCSDPQQLGRAEAEG
QGPVLPWLKRTARDLRLWIVAGTVPLPPDGRPQDRPNACSLLIDEHGQRVARYDKVHLFD
AEVADSRQQYRESDTYGAGQRLVVADTPVGRLGMTVCYDLRFAELYMALRDAGAELISAP
SAFTTVTGEAHWTTLIRCRAIETQCYVLAAAQVGMHPGGRVTYGHSSIVDPWGRLLCEQA
AAETALLAERDVPEQAAIRQRMPVQRHRRFSVPCLITDCLE
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgtcggtaatccagatgaccagccaagccgatgtcgccggcaatctagctgcc
gcccggcgcctgctcgagcaggctgccgcggccggggcccgcttggcggtgctgccagag
aacttcgccgccatgggctgcagtgacccacagcagctggggcgcgctgaagcggaaggc
caagggcctgttctgccctggttgaaacgtaccgcgcgcgacctcagattgtggattgtc
gctggaaccgtgccgctgccacccgacggccgtccgcaggaccggcccaatgcgtgttcg
ctgctcatcgacgagcacggacagcgggtcgcgcgatatgacaaggtgcacctgttcgac
gccgaggtggccgacagtcggcagcagtaccgcgaatccgatacctacggtgcagggcag
cggctggtcgtggccgacacgccggttggtcggctgggcatgaccgtctgctacgacttg
cgctttgccgagttgtacatggcgctgcgcgacgcaggggccgaactgatcagtgcgccc
tctgccttcaccacagtgaccggtgaggcacactggacgactctgatccgctgccgcgcc
atagagacgcagtgctacgtactggctgccgctcaggtcggtatgcaccccggcggtcgc
gtcacctatgggcattcgtctatcgttgacccttggggtcggttgttgtgcgagcaggcg
gctgctgagacagcgctgctcgccgaacgagatgtgcccgagcaggcggccatccgccag
cgcatgccggtgcagcgccaccgccgtttttccgtcccgtgcttgatcacggactgtctg
gagtga

DBGET integrated database retrieval system