KEGG   Pseudonocardia sp. EC080625-04: FRP1_01785Help
Entry
FRP1_01785        CDS       T04054                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
psee  Pseudonocardia sp. EC080625-04
Pathway
psee03010  Ribosome
Brite
KEGG Orthology (KO) [BR:psee00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    FRP1_01785
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:psee03011]
    FRP1_01785
Ribosome [BR:psee03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    FRP1_01785
  Bacteria
    FRP1_01785
  Archaea
    FRP1_01785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ALE75902
Position
396011..396397
Genome map
AA seq 128 aa AA seqDB search
MLEPTRARAVARFVRSSPMKTRRVVDLVRGLPVSEALAILRFSPQSAAEPVAKVVASAAA
NAENNLDLDPDTLVVAVAMVDEGPTLKRIRPRAQGRAYRIRKRTSHITIEVESVPAKAGR
RGAKGRAR
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgagccgactcgtgcgcgtgccgtggcacggttcgtccgtagctcgccgatgaag
acccgccgcgtcgtggacctggtccgcggcctgccggtgtccgaggcgctcgcgatcctg
cggttctcgccgcagtcggctgcggagcccgtggcgaaggtcgtggccagcgccgcggcc
aacgcggagaacaacctggacctggacccggacaccctcgtggtggccgtggcgatggtc
gacgagggcccgacgctgaagcgcatccgtccgcgtgcccaggggcgcgcctaccggatc
cgcaagcggacgagccacatcaccatcgaggtcgagtcggtccccgcgaaggccggccgt
cgtggtgcgaaggggagggcccgctga

DBGET integrated database retrieval system