KEGG   Pseudonocardia sp. EC080625-04: FRP1_09150Help
Entry
FRP1_09150        CDS       T04054                                 

Definition
(GenBank) dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
psee  Pseudonocardia sp. EC080625-04
Pathway
psee00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:psee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    FRP1_09150
Enzymes [BR:psee01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     FRP1_09150
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     FRP1_09150
    1.1.1.-  
     FRP1_09150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ALE73212
Position
1959366..1960418
Genome map
AA seq 350 aa AA seqDB search
MRAVVYRGPGQLDITDVPEAPVGAGEVRLKVGFNGICGSDLHEYYAGPIFIPNGEKHPLT
GRELPLTLGHEFSGTVVEVGSGVDGVETGDRVAVMPLYTCGTCARCSEGRYNVCATIGFH
GLMADGGMAESTVVPAHMLHKLPDDVSLEMGALVEPMAVAYHAAKLGDVQPGATALVFGA
GPIGIGLWFALRGTGVDNVRVVEPSPTRRQAIERLGADTLDPTAVDVPAVVADLTNGRGA
DACYDAAGVAPAVATALDSLGAGRPMVSVAIYETPLVTPLLNLVLGESRIQGSLCYTHED
YRAVIELMANGHYDTTGWMEKIAMADVVEEGFEALHAGRKMKVLVDPSVA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcggtcgtctaccggggccccggacagctcgacatcaccgacgtgcccgaggca
cccgtcggcgccggggaggtgcggctgaaggtcgggttcaacggcatctgcggttccgac
ctgcacgagtactacgccggccccatcttcatcccgaacggcgagaagcacccgctgacc
ggccgcgagctgccgctgaccctgggtcacgagttctccggcaccgtcgtcgaggtcggg
tccggggtcgacggcgtcgagaccggcgaccgggtcgcggtgatgccgctctacacctgc
gggacctgcgcgcggtgcagcgagggccgctacaacgtctgcgcgacgatcggcttccac
ggcctgatggccgacggcggcatggccgagtcgaccgtcgtcccggcgcacatgctgcac
aagctccccgacgacgtgtcactggagatgggcgccctcgtcgagccgatggcggtggcc
taccacgcggcgaagctcggcgacgtgcagccgggcgcgaccgcactggtgttcggcgcg
ggcccgatcgggatcgggctgtggttcgcgctgcgcgggacgggcgtcgacaacgtccgg
gtggtcgagccgtcgccgacccgcaggcaggcgatcgagcggctcggcgccgacaccctc
gacccgaccgccgtggacgtgcctgcggtcgtcgccgacctgacgaacgggcggggcgcc
gacgcctgctacgacgccgccggcgtggcccccgccgtcgcgaccgccctcgactccctg
ggcgcgggacggccgatggtcagcgtcgcgatctacgagacgccgctggtgacgccgctg
ctcaacctcgtgctgggcgagtcccggatccagggctcgctctgctacacccacgaggac
taccgcgccgtcatcgagctcatggcgaacgggcactacgacacgaccggctggatggag
aagatcgccatggccgacgtcgtggaggaggggttcgaggccctccacgccggccggaag
atgaaggtcctggtcgacccctccgtggcctga

DBGET integrated database retrieval system