KEGG   Pseudoflavitalea sp. 5GH32-13: D3H65_05495Help
Entry
D3H65_05495       CDS       T05640                                 

Definition
(GenBank) phospholipase C, phosphocholine-specific
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
pseg  Pseudoflavitalea sp. 5GH32-13
Pathway
pseg00562  Inositol phosphate metabolism
pseg00564  Glycerophospholipid metabolism
pseg01100  Metabolic pathways
pseg01110  Biosynthesis of secondary metabolites
pseg02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pseg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    D3H65_05495
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    D3H65_05495
   00565 Ether lipid metabolism
    D3H65_05495
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    D3H65_05495
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:pseg02042]
    D3H65_05495
Enzymes [BR:pseg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     D3H65_05495
Bacterial toxins [BR:pseg02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   D3H65_05495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756
Motif
Other DBs
NCBI-ProteinID: AXY73462
UniProt: A0A3B7MGH4
Position
complement(1440085..1442613)
Genome map
AA seq 842 aa AA seqDB search
METRRSFLKKASILSGGAGLLQALPASIAKAMAINPVAGSTWKDAEHVVFLMQENRSFDH
TFGTLQGVRGFNDPRAITLPDNNKVWLQTNAAGETFAPFHLDIKNTKATWMNSLPHSWSN
QVDARNNGKYDRWLQAKPSGNKAYKEMPLTLGYHTRQDIPFYYSLADAFTVCDQHFCSSL
TGTTPNRLYFWSGTIREKPHENVMARVWNGDADYGNWANWTTFPERLEENDVSWKVYQNE
ISVGVGFEGEEDAWLANFTDNPLEFFLQYNVKLSAGYITYLPKAIARLTAEIKQAEDKWL
QPGQPAAEIEKQRKRIEGMKRQLLSLQGDQQVYTIEKYEQLSQREKNLHEKAFTTNKKDP
YYHQLDTLKYKDGNTEREMKLPKGDILHQFRSDVNEGKLPTVSWIVAPENFSDHPGAAWY
GAWYLSEVMDILTKDPEVWKKTILVLTYDENDGYFDHVPPFVAPHPNKKETGFTTEGIPT
GVEYVTTSQQSSNARDARESAIGLGFRVPLVIASPWTRGGWVNSEVCDHTSSLQFLEKFL
SNKLGRPIVEPNITTWRRTVCGDLTSAFRPYNGEKITSPAPIPRDPFVESIHKAQFKQLP
SNFRKLTKEEITLANSKPAAAAFMPVQEKGIRNANALPYELYAEGVISEDKQSFDIVLKA
ANYRFGEAAAGAPFQVYAPGIYKGEKVNVRDYAVAAGGALADKWKLADFDKGIYHLQVYG
PNGFFREFIGSQQEPPVFIRSVYEPAEKNPSQLSGRLVLTFANGLPNPQTVIITDNAYKT
ANQTVIVQPGRESVVIINTDKSHGWYDFTFSVKGHASYSKRYAGRIETGRHSKTDPFMGR
VV
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgaggagatcatttctaaagaaagcatccattttatcaggcggcgccggatta
ttgcaggccctgcccgcctccattgccaaagccatggccatcaaccccgttgccggcagc
acctggaaagatgccgaacatgtagtgttcctgatgcaggaaaaccgttccttcgaccac
acttttggcaccctgcagggtgttcgtggcttcaatgatccccgtgccattaccctgccc
gataacaacaaagtttggctgcaaaccaatgcagccggcgaaaccttcgccccttttcac
ctggatatcaaaaacaccaaagctacctggatgaactccctgccccactcctggagcaac
caggtagatgcccgcaacaacggcaaatacgatcgctggctgcaggccaaaccttccggc
aataaagcctataaggaaatgcccctcaccctgggctaccatacgcggcaggacattcct
ttctattattccctggccgatgccttcaccgtgtgcgaccaacacttttgctcttccctc
accggcaccacgcccaaccgcctgtatttctggtcgggcaccatccgcgaaaagcctcat
gaaaatgtaatggcccgcgtttggaacggcgatgccgactatggcaactgggccaactgg
accacttttcccgaaagactggaagagaatgacgtatcctggaaagtgtaccagaatgag
atcagcgtgggcgtgggatttgaaggagaagaagatgcctggctggccaactttaccgat
aatccgcttgagttcttcttgcaatacaacgtaaaattgtctgccgggtatatcacctac
ctgccaaaggccattgcccgattgaccgctgaaataaagcaggctgaagacaaatggcta
caacccggccagccggctgcagaaatagaaaaacagcggaaaaggatcgaaggcatgaaa
cggcaactgctgtctctgcaaggcgaccagcaagtgtataccattgaaaaatatgagcag
ctgtcccagcgggaaaagaacctgcacgagaaagcctttaccaccaacaaaaaggacccc
tattatcatcagttggataccctgaaatacaaagacggcaataccgaacgtgaaatgaaa
ctgcccaagggcgatatcctgcaccagtttcgcagtgatgtcaatgaaggcaagttgccc
accgtatcctggatcgtagcgccggaaaacttttccgatcaccccggtgccgcctggtat
ggcgcctggtacctcagtgaagtgatggacatacttaccaaagaccccgaggtatggaaa
aagaccatcctggtactcacctacgatgaaaacgatggctattttgaccatgtacctccc
tttgtagccccgcatcccaataaaaaagaaaccggttttaccaccgaaggcattcccacc
ggggtggaatatgtaaccaccagccagcaatcatccaatgcccgggatgcccgcgaaagc
gccattggcctgggcttccgtgtacccctggtgattgcctcaccgtggacccgcggcggc
tgggtcaattcggaagtatgcgaccacacctcctccctccaattcctcgaaaaattcctg
agcaataaactgggccgtcccatcgtcgagcccaatatcaccacctggcgtcgtacagta
tgcggcgacctcacctctgcgttcagaccctataatggcgaaaaaataacgagcccggca
cccataccacgtgatcctttcgtagaaagcatccacaaagcacagtttaaacaactgccc
tccaatttccgcaagcttaccaaagaagaaataaccctggccaattcaaaacctgctgcg
gctgcttttatgccggtacaggaaaaaggtatccgcaacgccaatgccctgccctacgag
ttgtatgcagaaggtgttattagtgaagacaaacaatcatttgatattgtactgaaagca
gccaattaccggtttggcgaagcggctgcaggcgctcctttccaggtatatgcccctggc
atttataaaggagaaaaggtcaatgtgcgcgactatgcagtagctgccggaggcgcactg
gccgacaaatggaaactggctgactttgataaaggcatctatcacctgcaggtatatggt
cccaatggattcttcagggagtttatcggcagccagcaagaaccacctgtgttcatccgg
tccgtttatgagccggcagagaaaaacccttcccaattatccggcaggctggtattaaca
tttgccaatgggctacccaatccacaaacagtgatcataactgacaatgcctataaaaca
gccaaccaaacagtgatcgttcaaccaggccgtgaaagcgtagtcattatcaatacagac
aaaagccatggctggtatgactttaccttcagcgttaaaggtcatgcatcctatagcaag
cggtatgccggtcggatagaaacaggcaggcatagtaaaaccgatccgttcatgggaaga
gtggtataa

DBGET integrated database retrieval system