KEGG   Pseudoflavitalea sp. 5GH32-13: D3H65_11370Help
Entry
D3H65_11370       CDS       T05640                                 

Definition
(GenBank) class 1 fructose-bisphosphatase
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
pseg  Pseudoflavitalea sp. 5GH32-13
Pathway
pseg00010  Glycolysis / Gluconeogenesis
pseg00030  Pentose phosphate pathway
pseg00051  Fructose and mannose metabolism
pseg00680  Methane metabolism
pseg01100  Metabolic pathways
pseg01110  Biosynthesis of secondary metabolites
pseg01120  Microbial metabolism in diverse environments
pseg01130  Biosynthesis of antibiotics
pseg01200  Carbon metabolism
Module
pseg_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pseg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D3H65_11370
   00030 Pentose phosphate pathway
    D3H65_11370
   00051 Fructose and mannose metabolism
    D3H65_11370
  09102 Energy metabolism
   00680 Methane metabolism
    D3H65_11370
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pseg04147]
    D3H65_11370
Enzymes [BR:pseg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     D3H65_11370
Exosome [BR:pseg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   D3H65_11370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase
Motif
Other DBs
NCBI-ProteinID: AXY74540
UniProt: A0A3B7MND2
Position
complement(3046545..3047552)
Genome map
AA seq 335 aa AA seqDB search
MSTINRQVMTLDEFTIQQLRDFPHATGELSGLLRDMGRAAKRVNVEVNKAGLVDILGDAG
AVNVQGEDVKKLDIFANNQFMGVLQHGVSCAGIASEELDDFVAFDDEISCNSKYICLFDP
LDGSGNIDVNVSIGTIFSVYRRISPIGTPVIAADFLQPGHKQVAAGYMVYGSSTMLVYGT
RRGVNGFTLDPSIGEFCLSHPNIKCPGFGKIYSVNHGNFFQYAPGVQKYIDKCQKKTKDN
GGPYTQRYIGSMVADVHRNLIKGGIFMYPGTIDKPKGKLRLLYECNPFAFIVEVAGGKAT
NGSQRILDVDPTELHQRSPLFIGSKGMMEEFEACL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgattaaccgccaagtaatgaccctggatgagttcaccattcaacagctaagg
gatttcccccatgccaccggtgaactgagcggcctcctgcgcgatatgggccgggctgcc
aaaagggtgaatgtggaggtcaataaagccgggctggtagatatattgggcgatgcgggc
gccgtgaacgtgcagggagaggatgtgaagaaactggacatatttgccaacaaccagttt
atgggcgtgttgcaacatggggtgagttgtgccggtatagccagcgaagaactggatgac
tttgtggcttttgatgatgagatcagctgtaactccaaatacatctgcctgttcgatccc
ctcgatggcagtggtaatatagatgtaaatgtgtccatcggtaccattttcagcgtgtac
cggcgcatcagcccgatcggcacacccgttatcgcagccgattttctgcagccgggccac
aagcaggtagctgccggttatatggtatatggttcttctaccatgctggtgtatggtaca
cgccggggcgtaaatggctttaccctcgatccttccattggtgaattttgcctcagccat
cctaatatcaaatgccccgggtttggtaaaatatattctgtcaaccatggcaacttcttc
cagtacgcacccggtgtacagaagtatatcgacaaatgccagaagaagacaaaggacaat
ggcggaccttacacacaacgttatattggcagtatggtagccgatgtacaccgcaacctt
attaagggcggcatctttatgtatccgggcactatcgataagcccaagggtaagctgcgt
ttgctttatgagtgcaatccctttgcgtttatagtagaagtggcgggtggtaaggctacc
aatggcagccagcgtattttggatgtcgatcctaccgaactgcaccagcgttcgcccctt
ttcattggcagcaaaggcatgatggaagaatttgaagcctgcttataa

DBGET integrated database retrieval system