KEGG   Pseudoflavitalea sp. 5GH32-13: D3H65_25285Help
Entry
D3H65_25285       CDS       T05640                                 

Definition
(GenBank) N-acetyltransferase
  KO
K13018  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase [EC:2.3.1.201]
Organism
pseg  Pseudoflavitalea sp. 5GH32-13
Pathway
pseg00520  Amino sugar and nucleotide sugar metabolism
pseg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pseg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    D3H65_25285
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:pseg01005]
    D3H65_25285
Enzymes [BR:pseg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.201  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase
     D3H65_25285
Lipopolysaccharide biosynthesis proteins [BR:pseg01005]
 Unusual sugar
  D3H65_25285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2
Motif
Other DBs
NCBI-ProteinID: AXY77087
UniProt: A0A3B7MT88
Position
6585653..6586228
Genome map
AA seq 191 aa AA seqDB search
MKYWAHETAVIDPGSSIGDYTRIWHFSHIMPGCVIGERCNLGQNVVVMPEVVIGNNVKIQ
NNVSIYTGVVCEDDVFLGPSMVFTNVINPRSAIVRKHEYQKTLVRKGASIGANATIICGN
TIGEYALIGAGTVITKDVKPYALVIGNPGRQVGWVSEYGHQLEFNEKGMAICPESKQVYR
LENEQVKKNGQ
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattgggcacacgaaacggctgttattgatcccggtagtagcatcggggattat
actcgtatatggcatttttcgcatattatgcctggatgcgtgatcggagaacgctgtaac
ctgggtcagaacgtcgttgtgatgcctgaggtagtgatagggaacaatgtaaagattcaa
aacaacgtatccatttatactggtgtggtttgcgaagatgatgtttttctgggtccatcg
atggtatttaccaacgttatcaatccaagaagtgccattgtacgtaaacatgaatatcaa
aaaacactggtaagaaaaggtgcctcgatcggcgccaatgctactatcatttgtggcaat
accattggcgaatacgcgttaataggcgccggcactgtaataactaaagacgtaaagcct
tatgccctggtgatcggcaatcccggcaggcaggtaggttgggtaagtgaatatggacac
caactggagtttaatgaaaaaggaatggcaatttgcccggaaagtaaacaagtatatcga
ctggaaaacgaacaggtgaagaaaaatggccagtaa

DBGET integrated database retrieval system