KEGG   Pseudonocardia sp. HH130629-09: XF36_02085Help
Entry
XF36_02085        CDS       T04082                                 

Definition
(GenBank) GDP-mannose pyrophosphorylase
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
pseh  Pseudonocardia sp. HH130629-09
Pathway
pseh00051  Fructose and mannose metabolism
pseh00520  Amino sugar and nucleotide sugar metabolism
pseh01100  Metabolic pathways
pseh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pseh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    XF36_02085
   00520 Amino sugar and nucleotide sugar metabolism
    XF36_02085
Enzymes [BR:pseh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     XF36_02085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep DUF4954 Hexapep_2
Motif
Other DBs
NCBI-ProteinID: ALE82069
UniProt: A0A0M3UAB9
Position
434792..435862
Genome map
AA seq 356 aa AA seqDB search
MQDVEAVVLVGGKGTRLRPLTLSAPKPMLPTAGVPFLAHLLSRIREAGIRRAVLGTSYLA
ETFEEHFGDGSSLGLDLTYVTETEPLGTGGGIRNVAGKLSAEHVMIFNGDVLAGTDLTAV
ADTHRSTGADVTLHLVRVQNPRAFGCVPTDPTGRVLEFLEKTEDPPTDQINAGCYVFRRE
VIDTIPAGRPVSVERETFPDLLASGAHVQGHVDVAYWRDMGTPGDLVHGSADLVRGVAPS
AALPGPTGESMVLEGAEVAADAFVFGGTTVGRGARIGSGARVEGSMLFDGAVVRAGAVVE
NSVIGAGAVVEEGASIRDTVVGDRAVIGAHCELRHNMRVWPDVTLPPHGVRFSPDV
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgcaggacgtcgaggcggtcgtgctggtcgggggcaagggcacccggctgcggccactg
accctgtcggcgcccaagccgatgctgccgacggcgggggtgccgttcctggcgcacctg
ctgtcgcggatccgcgaggcgggcatccggcgggcggtgctgggtacgagctacctggcg
gagacattcgaggagcacttcggcgacggctcgtcgctggggctggacctcacctacgtg
accgagaccgagccgctgggcacgggcgggggcatccgcaacgtggccggcaagctctcg
gccgagcacgtcatgatcttcaacggcgacgtgctggcgggcaccgacctgaccgccgtc
gccgacacccaccggagtaccggtgccgacgtgacgctgcacctggtgcgggtgcagaac
ccgcgggccttcggctgcgtccccaccgacccgaccggccgggtgctggagttcctcgag
aagaccgaggacccgccgaccgaccagatcaacgccgggtgctacgtcttccgtcgcgag
gtgatcgacacgatccccgcgggcaggccggtgtcggtggagcgcgagacgttccccgac
ctgctcgcctccggggcgcacgtgcagggccacgtcgacgtcgcgtactggcgcgacatg
ggcacccctggcgacctggtgcacggctcggcggacctggtccgcggggtcgcgccctcg
gcggcgctgcccggcccgacgggcgagtcgatggtgctggagggggccgaggtggccgcc
gacgcgttcgtgttcggcgggacgaccgtcggccgcggcgcccggatcggctccggggcc
cgggtcgagggctccatgctgttcgacggcgcggtggtccgggccggagcggtcgtggag
aactcggtgatcggggccggcgcggtcgtcgaggagggcgccagcatccgcgacaccgtg
gtcggcgaccgggccgtgatcggcgcgcactgcgagctgcggcacaacatgcgggtgtgg
ccggacgtcacgctgccgccccacggggtccggttctcgcccgacgtgtga

DBGET integrated database retrieval system