KEGG   Pseudonocardia sp. HH130629-09: XF36_15630Help
Entry
XF36_15630        CDS       T04082                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
pseh  Pseudonocardia sp. HH130629-09
Brite
KEGG Orthology (KO) [BR:pseh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pseh03009]
    XF36_15630
Enzymes [BR:pseh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     XF36_15630
Ribosome biogenesis [BR:pseh03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    XF36_15630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 TruB_N
Motif
Other DBs
NCBI-ProteinID: ALE84402
UniProt: A0A0M4QIR4
Position
complement(3416072..3416983)
Genome map
AA seq 303 aa AA seqDB search
MPVPDGLDGMRIDAGLSRLLGLSRTVVATLAESGRISVDGREAGKSDRLPGGSWLEVELP
DAPAPAVIEGPAEVVAGLTVLHSDDDIVVVDKPVGVAAHPSPGWTGPTVTGGLAALGFRL
STSGAAERQGIVHRLDVGTTGVMVVATSEHAYTELKRAFKERTVDKRYHAVVQGHPDPSS
GTIDAPIDRHPRHDYRFAVMQSGKPSVTHYDTIEAFRSASLLDVHLETGRTHQIRVHFSA
LRHPCVGDITYGADPTLAKRVGLSRQWLHARTLGFAHPADGRHVEFTSPYPADLDAALDV
LRD
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccggtgcctgacgggctggacggcatgcggatcgacgccgggctgtcccggctgctg
gggctgtcgcggaccgtcgtcgccacgctggccgagtccggccggatctcggtcgacggt
cgtgaggccggcaagtccgaccggctgccgggtgggtcctggctggaggtcgagctgccc
gacgcgcccgcgcccgcggtcatcgagggcccggccgaggtcgtcgcgggcctgacggtg
ctgcactccgacgacgacatcgtcgtcgtcgacaagccggtcggggtcgccgcgcacccc
tccccgggctggaccgggccgaccgtgaccggcgggctcgccgcgctcgggttccggctg
tccacctccggcgccgccgagcggcagggcatcgtgcaccggctcgacgtcggcaccacc
ggggtgatggtcgtagccacctccgagcacgcctacaccgagctcaagcgggccttcaag
gaacgcaccgtcgacaagcgctaccacgccgtcgtgcagggacacccggacccgtcgtcg
ggcacgatcgacgccccgatcgaccggcacccgcgccacgactaccggttcgcggtgatg
cagagcggcaagcccagcgtcacccactacgacaccatcgaggcgttccgctcggccagc
ctgctcgacgtgcacctggagaccggccgcacccaccagatccgggtgcacttctccgcg
ctgcgccacccctgcgtcggcgacatcacctacggcgccgacccgacgctggccaagcgg
gtcgggctgtcccggcagtggctgcacgcccgcacgctcgggttcgcccaccccgccgac
ggccggcacgtcgagttcaccagcccctacccggccgacctcgacgcggcgctggacgtc
ctgcgggactga

DBGET integrated database retrieval system