KEGG   Pseudactinotalea sp. HY158: GCE65_10465Help
Entry
GCE65_10465       CDS       T06271                                 

Gene name
truB
Definition
(GenBank) tRNA pseudouridine(55) synthase TruB
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
psei  Pseudactinotalea sp. HY158
Brite
KEGG Orthology (KO) [BR:psei00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:psei03016]
    GCE65_10465 (truB)
Enzymes [BR:psei01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     GCE65_10465 (truB)
Transfer RNA biogenesis [BR:psei03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    GCE65_10465 (truB)
 Prokaryotic type
    GCE65_10465 (truB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TruB_N TruB_C TruB_C_2
Motif
Other DBs
NCBI-ProteinID: QGH69881
Position
complement(2378359..2379315)
Genome map
AA seq 318 aa AA seqDB search
MNAPDGLLLLDKPAGLTSHGAVARTRRALGTRKVGHAGTLDPMATGLLVLGIGRATRLLT
YIVGVDKTYTATIRLGQGTNTDDAEGEATSSPGARLAAGPERAVRLELDGIEAVAAGLRG
PIEQVPSAVSAIKVDGKRAYARVRAGEEVALPARPVTIHRFALAEPRASVAADGTPVVDV
DAVIDCSSGTYVRALARDLGARLGCGGHLTALRRTRVGPFDLDPEPTATAARTAAVRADD
TLPRTAPDALLSVTTALRLLLPARELTEGEARAVRYGQSLAAGGMAELAGAFDPAGRGIA
VLSLDGERARPVLVLDPA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
ctgaacgcccccgacggcctgctcctgctcgacaagccggcgggcctcacctcccacggc
gccgtcgcccgcacgcggcgcgccctggggacccgcaaggtcggacacgccggcaccctc
gatccgatggccacgggcctgctcgtgctcggcatcgggcgtgccacccggctgctcacc
tatatcgtcggcgtggacaagacctatacggccaccatccggctcggccagggcacgaac
accgacgacgccgagggggaggcgacctcctccccgggcgcccgcctcgccgccggcccg
gagcgcgccgtccggctcgagctggacgggatcgaggccgtcgccgcggggctgcgcgga
ccgatcgagcaggttccgagcgcggtctcggccatcaaggtcgacggcaagcgcgcctac
gcccgggtgcgcgcgggggaggaggtcgccctgcccgcccggcccgtgacgatccaccgg
ttcgcgctggccgagccccgcgcgtcggtcgccgccgacggcacaccggtcgtcgacgtc
gacgccgtgatcgactgctcctccggcacctacgtgcgcgccctcgcccgggatctcggc
gcccgactcggctgcggcggccacctcaccgcgctgcggcgcacccgggtcggacccttc
gacctcgaccccgaacccaccgccacggccgcccggactgcggcggtccgcgccgacgac
accctgccccggaccgccccggatgcgctgctgagcgtgaccacggcgctgcggctgctc
ctgcccgcccgcgagctgaccgagggcgaggcccgggcggtccgctacggccagtcactc
gcggcgggcggcatggccgagctcgccggcgcgttcgacccggccgggcgcgggatcgcc
gtgctgagcctcgacggtgagcgggcccgccccgtgctcgtgctcgacccggcctga

DBGET integrated database retrieval system