KEGG   Pseudomonas sp. MRSN12121: TO66_16595Help
Entry
TO66_16595        CDS       T03702                                 

Definition
(GenBank) aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
psem  Pseudomonas sp. MRSN12121
Pathway
psem00860  Porphyrin and chlorophyll metabolism
psem01100  Metabolic pathways
psem01110  Biosynthesis of secondary metabolites
psem01120  Microbial metabolism in diverse environments
Module
psem_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:psem00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TO66_16595
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:psem01007]
    TO66_16595
Enzymes [BR:psem01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     TO66_16595
Amino acid related enzymes [BR:psem01007]
 Aminotransferase (transaminase)
  Class III
   TO66_16595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 TetR_C_34 Phage_integrase
Motif
Other DBs
NCBI-ProteinID: AJO78814
UniProt: A0A0C5E2Z4
Position
3678457..3679839
Genome map
AA seq 460 aa AA seqDB search
MTLGLNLDRVASCYQSELQRFAERHPRSADFYRENLKHWLYGAPLHWMQQWPGLYPILVS
DAQGATLTDCDGNRYVDFALGDTGAMFGHAQPAVAQAIAHQARHGSTLMLPTEDSLWVGQ
ELARRFGLPFWQVTTSATDANRFVLRLCRMITGREKVLVFNCNYHGSVDESQVEFDASGR
MIPREGVHANGLRHEATTRLVEFNDLAALEAALAHGDVAAVLTEPFMTNVGMVPPAPGFH
EGLRALTRRFEVPLIIDETHTISCGPGGYSGEHGLQPDFFVLGKCIAGGIPTAVWGASQA
MAERIWQVLPHFQPGQAINHFGFGGTLAGNALQMAAMRATFSEVMSEANYAHMIALAERL
RDGVQTLIDKHRLPWHVTRIGARVEYLFMDHAPRNGGEAHHARHGLIEAYLHLYLLNRGV
LLTPFHNMALLCPAASSDDVDLHNRLLDECLGTVVEGASQ
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgacccttggcctcaacctcgaccgcgtcgccagttgctaccagtccgagctgcaacgg
ttcgccgaacgccacccgcgctccgccgacttttaccgggaaaacctcaagcactggctc
tacggcgcgccgttgcactggatgcagcaatggccggggctgtatccgatcctggtgagc
gatgcccagggcgcgaccctgaccgactgcgacggcaaccgctacgtcgacttcgccctg
ggcgataccggcgccatgttcggccatgcccagccggcggtggcccaggccatcgcccat
caggcgcggcacggctccaccctgatgctgccgaccgaggacagcctgtgggtcggccag
gaactggcgcggcgcttcggcctgccgttctggcaggtcaccacctccgccaccgacgcc
aaccgtttcgtgctgcgcctgtgccggatgatcaccggccgcgagaaagtgctggtgttc
aactgcaactaccacggcagcgtcgacgagtcccaggtcgagttcgacgccagcggccgg
atgattccccgcgaaggcgtgcacgccaacggcctcaggcacgaggccaccacccgcctg
gtggaattcaacgacctggcggcgctggaggcggccctggcccatggcgacgtggccgcg
gtactgaccgaacccttcatgaccaacgtcggcatggttccgcccgccccgggcttccat
gaggggctgcgcgcgctgacccggcgtttcgaggtgccgctgatcatcgacgaaacccac
accatttcctgcggccctggcggctacagcggtgaacacggcctgcagccggacttcttc
gtgctcggcaaatgcatcgccggcggcatcccgaccgccgtctggggcgccagccaggcc
atggccgagcgcatctggcaggtgttgccacactttcagcccgggcaggcgatcaaccac
ttcggcttcggcggcaccctggccggcaacgccttgcagatggccgccatgcgcgccacc
ttcagcgaggtcatgagcgaggccaactacgcgcacatgatcgccctggccgaacgcctg
cgggacggggtccagacgctgatcgacaagcaccgcctgccctggcatgtgacacggatc
ggcgcccgggtcgagtacctgttcatggaccacgccccgcgcaacggcggcgaagcccac
cacgctcgccacggcctgatcgaggcctacctgcacctctacctgctcaaccgcggggta
ttgctgacgccgttccacaacatggcactgctctgcccggccgccagttccgatgacgtc
gacctgcacaaccgcctgctggacgagtgcctgggcacggtcgtcgaaggagccagccaa
tga

DBGET integrated database retrieval system