KEGG   Pseudomonas sp. MRSN12121: TO66_18475Help
Entry
TO66_18475        CDS       T03702                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psem  Pseudomonas sp. MRSN12121
Pathway
psem00071  Fatty acid degradation
psem00072  Synthesis and degradation of ketone bodies
psem00280  Valine, leucine and isoleucine degradation
psem00310  Lysine degradation
psem00362  Benzoate degradation
psem00380  Tryptophan metabolism
psem00620  Pyruvate metabolism
psem00630  Glyoxylate and dicarboxylate metabolism
psem00640  Propanoate metabolism
psem00650  Butanoate metabolism
psem00900  Terpenoid backbone biosynthesis
psem01100  Metabolic pathways
psem01110  Biosynthesis of secondary metabolites
psem01120  Microbial metabolism in diverse environments
psem01130  Biosynthesis of antibiotics
psem01200  Carbon metabolism
psem01212  Fatty acid metabolism
psem02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TO66_18475
   00630 Glyoxylate and dicarboxylate metabolism
    TO66_18475
   00640 Propanoate metabolism
    TO66_18475
   00650 Butanoate metabolism
    TO66_18475
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TO66_18475
   00072 Synthesis and degradation of ketone bodies
    TO66_18475
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TO66_18475
   00310 Lysine degradation
    TO66_18475
   00380 Tryptophan metabolism
    TO66_18475
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TO66_18475
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TO66_18475
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TO66_18475
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psem04147]
    TO66_18475
Enzymes [BR:psem01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TO66_18475
Exosome [BR:psem04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TO66_18475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AJO79160
UniProt: A0A0C5EB53
Position
complement(4062331..4063572)
Genome map
AA seq 413 aa AA seqDB search
MSHSGQYSSFTDVAIVEAVRTPWIDLGGALAQVSPIDLGIKVGREVLARAALDPAAVDSV
LAGSMAQASFDAYMLPRHIGLYSGVPQAVPALAVQRICATGFELLHQAAWQLEQGVQLAL
CVASESMSRNPIAAYSHRDGFRLGAQVGFKDFLWEALYDPAAGLDMIATADNLARRHGLS
REAVDRFALDSHQRALQAQGEGWFEPELVALGNERFELAGYQPRQLDLPRGVERVTHDSH
PRPTDLAALQRLRAVHADGVQTAGNSCALVDGAAAALVARASSTRGPVLAHLLASAVVGV
APEFMGIGPAPAIQLLLQRSGLSLGDIGLLEINEAQAAQVLAVAQVLELDRERLNRRGGS
IALGHPLAASGLRLVLTLARQLREHNLRYGIASACVGGGQGMALLIENPAYRG
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgagccattccgggcagtattcgagctttaccgatgtggcaatcgtcgaggccgtgcgt
acgccgtggatcgatctcggcggggccctggcccaggtgtcgccgatcgacctggggatc
aaggtcgggcgcgaggtgctggcccgggccgcgttagaccccgccgcggtggatagcgtg
ctcgccggttccatggcccaggccagtttcgatgcctacatgctgccgcggcacatcggc
ctctacagcggcgtgccgcaagcggtgccggcgctggcggtgcagcgcatctgcgccacc
ggtttcgaactgctgcaccaggctgcttggcaactggaacagggcgtgcaactggccctg
tgcgtggcgagcgaatccatgtcgcgcaatcccatcgccgcctacagccaccgcgacggt
ttccgcctcggtgctcaggtggggttcaaggacttcctgtgggaagccctctacgacccg
gccgcgggcctggacatgatcgccaccgccgacaacctcgctcgccgccatggcctgagt
cgcgaagcggtggaccgcttcgccctcgacagccatcagcgggcgctgcaggcccagggc
gagggctggttcgagcctgagctggtggcgctgggcaatgagcgcttcgagctggccggc
taccagccacgccagctggatttgccacggggcgtggagcgcgtgacccacgacagccac
ccgcggcccacggacttggcggcattgcagcgcctgcgcgcggtgcatgccgacggcgtg
cagaccgccggcaatagctgcgccctggtcgacggcgcggccgccgcgctggtggcgcgc
gcctccagcacccgtgggccggtgctggcccatctgctggccagcgccgtggtgggggtg
gccccggaattcatgggcatcggcccggctccggcgatccaattgctgttgcaacgcagc
gggctgagcctgggcgatatcggcctgctggaaatcaacgaggcgcaggcagcccaggtg
ctggcggtggcccaggtgctggaactggaccgcgagcgcctcaaccgccgcggtggctcc
atcgccctcggccatcccctggccgccagcggcctgcgcctggtgctgaccctggcccgg
caactgcgcgagcacaacctgcgctacggcatcgcctcggcctgtgtcggcggcgggcag
ggcatggcgctgctgatcgagaatccggcctatcggggctga

DBGET integrated database retrieval system