KEGG   Pseudomonas sp. MRSN12121: TO66_23105Help
Entry
TO66_23105        CDS       T03702                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
psem  Pseudomonas sp. MRSN12121
Pathway
psem00480  Glutathione metabolism
psem00590  Arachidonic acid metabolism
psem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psem00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    TO66_23105
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    TO66_23105
Enzymes [BR:psem01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     TO66_23105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AJO80002
UniProt: A0A0C5EPQ2
Position
complement(5117025..5117576)
Genome map
AA seq 183 aa AA seqDB search
MWMRWLAVPAVLVAFSGAAWAAECPALLQGSLPKLRAKETIDLCQRFAGKPLVVVNTASF
CGFAPQFKGLEALYQRYKDQGLEVLGVPSDDFKQESKDGAETAKVCYVNYGVTFTMTEPQ
PVRGADAVHLFKMLAEQSSAPKWNFYKYVVDRQGKVIASFSSVTKPDSPELIEAVEKALA
SGS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgtggatgcgctggctggctgttccggcggtactcgtggcgttttccggtgccgcgtgg
gcggctgaatgccctgcgctgttgcagggttcgctgcccaagctgcgtgccaaggaaacc
atcgacctgtgccagcgctttgcaggcaagccgttggtggtggtcaacacggccagcttt
tgcggcttcgctccgcagttcaaggggctcgaggcgctctaccagcgctacaaggatcag
gggctggaagtgctgggcgtgccgtccgatgacttcaagcaggagtccaaggatggcgcg
gaaaccgccaaggtctgctatgtgaactacggcgtcactttcaccatgaccgagccgcag
ccggtcaggggggcggatgcggtccatctgttcaagatgctggccgagcagagcagtgcg
ccgaagtggaatttctacaagtatgtggtcgatcgccagggcaaggtgattgccagtttt
tccagcgtgaccaagccggacagtcctgagctgatcgaggcggtggagaaggcgctggcg
tccggatcctga

DBGET integrated database retrieval system