KEGG   Pseudomonas sp. MRSN12121: TO66_28455Help
Entry
TO66_28455        CDS       T03702                                 

Definition
(GenBank) magnesium transporter ApaG
  KO
K06195  ApaG protein
Organism
psem  Pseudomonas sp. MRSN12121
Brite
KEGG Orthology (KO) [BR:psem00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    TO66_28455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AJO81004
UniProt: A0A0C5E8H0
Position
6239117..6239497
Genome map
AA seq 126 aa AA seqDB search
MSDPRYQVDVSVVTRFLAEQSQPEQNRFAFAYTITVQNNGLLPAKLLSRHWVITDGDGHV
EEVRGSGVVGQQPLIAAGQSHTYSSGTVMTTRVGNMQGSYQMLAEDGKHFDAIIAPFRLA
VPGALH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcctcgctaccaggtcgacgtcagcgtcgtcacccgcttccttgccgaacag
tcgcaacccgaacagaaccgctttgccttcgcctacaccatcaccgtccagaacaatggc
ctgctgcccgccaagctgctgtcccggcactgggtgatcaccgatggcgacgggcacgtc
gaggaggttcgcggttccggcgtggttggccagcagccgctgatcgccgccggccaaagc
catacctatagcagcggtacggtcatgaccacccgcgtcggcaatatgcagggcagctat
cagatgctcgccgaagacggcaagcacttcgacgccatcatcgcgcccttccgcctggcc
gtgcccggagcgctgcactga

DBGET integrated database retrieval system